Search for Discord servers

🔎 Search
🏷️ Tags
🔞 Age Requirement
📊 Sorting
👥 Server Size
📅 Server Age
🌍 Language
🎭 Vibes

952 servers found

Blox Fruits Trading Server | Trading Discord server profile picture
Blox Fruits Trading Server | Trading
bloxfruitsbloxfruitblox-fruitsblox-fruitblox fruitsblox fruitblox fruit trading serverbloxsfruitsbloxs fruitsbloxsfruits
Description

Welcome to Blox Fruits Trading Server – the ultimate Blox Fruits Discord server! We’re the go-to place for safe and verified trades, real-time Blox Fruits stock prices, middleman services, and expert help for players of all levels. 💼 TRADE SMART: ✅ 24/7 Active Trading Community ✅ Fruit-for-Fruit, Gamepass & Limited Trading ✅ Trusted Middlemen to keep your deals safe 📈 INVEST WISELY: ✅ Live Fruit Market & Stock Charts ✅ Daily Value Updates for All Fruits ✅ Smart Trading Advice 🆘 GET HELP & LEVEL UP: ✅ Boss Guides, Crew Invites, and Leveling Support ✅ Friendly Community to Help All Seas & Levels ✅ Support Channels + Trading Guides 🎁 BONUSES: 🎉 Regular Fruit Drops & Gamepass Giveaways 🎖️ Reputation System for Verified Traders 🌍 Global Community – All Time Zones Supported Join the best Blox Fruits Discord today and take your trading and gameplay to the next level! [ 🔗 https://discord.com/invite/blox-fruit]

Today's activity
27.6k
1.7k
14
Server overview
23.1kTotal members
8months old
13Age requirement
The Writer's Library {{21+ RP Hub}} Discord server profile picture
The Writer's Library {{21+ RP Hub}}
friendlysocialroleplayrpcommunitywritingroleplayerroleplay partnerwritersactive
Description

Welcome to the Writers Library. All writing levels are welcome! We are a 21+ Role Play server. We do request your work be human written. Here you can find yourself lost in the pages of your own creations and meet other writers to join you.

Today's activity
4.4k
59
8
Server overview
365Total members
1years old
21Age requirement
Description

One of the few open and free MLP communities on Discord where everyone is welcome to be themselves. We offer a safe and supportive space for emotional expression, friendship, and healing.

Today's activity
17.5k
210
3
Server overview
9.0kTotal members
1years old
13Age requirement
Description

English Server, level 3 boosted!
🐦‍🔥 Guild tags
🌹 Different Platforms (Xbox, PC, etc.)
🌸 Lots of fun bots (always down to add!!)
🌺 Nitro Giveaways
🎀 Active Owner!
💫 Marvel Rivals / Marvel comics
- 100+ free guild tags (kpop, anime, vocaloid etc)☀️

(IN NEED OF ACTIVE MEMBERS!!!)

Today's activity
48
10
0
Server overview
1.3kTotal members
1years old
16Age requirement
Cherry Blossom BL Energy Discord server profile picture
Cherry Blossom BL Energy
communityanimesfwmangagaylgbtqblotakuyaoimlmmanhwamanhuafudanshiboys love13-17socialhangoutfriendsfunfriendlychatlgbtq+
Description

🌸 Cherry Blossom BL Energy — A cozy Boys’ Love chat community for fans, recommendations, discussions & safe vibes. 🌸 Cherry Blossom BL Energy Welcome to our peaceful garden beneath the cherry blossoms — a cozy 16+ Boys’ Love community made for connection, comfort, and shared love for BL. The blossom garden is our main hangout space where you can: 💮 Chat freely about your favorite BL anime, manga, manhwa & novels 💮 Make new friends who share your interests 💮 Share edits, recommendations, thoughts & headcanons 💮 Relax in a calm, drama-free environment 💮 Just exist and vibe together Whether you're here for soft romance, emotional stories, chaotic ships, or wholesome comfort — you belong here. 🌷 Our Atmosphere We focus on: ✨ Cozy energy ✨ Respectful conversations ✨ LGBTQ+ positivity ✨ Safe interactions ✨ Community over chaos This is not an explicit server. We prioritize comfort and safety while still allowing open BL discussions in an appropriate way. 🌿 Community Rules Overview 💮 16+ Only – No one under 16 allowed. 💮 Respect Always – No harassment, hate, or discrimination. 💮 Safe LGBTQ+ Space – Everyone deserves to feel welcome. 💮 No Graphic NSFW – Keep content appropriate. 💮 Zero Tolerance for Minors in NSFW Contexts – Instant ban. 💮 No Creepy Behavior – No pressure DMs or unwanted flirting. 💮 Respect Privacy – No sharing DMs or personal info. 💮 No Drama or Spam – Keep the garden peaceful. If you're looking for a calm BL space that feels like late-night chats under falling petals instead of chaotic noise — Cherry Blossom BL Energy is waiting for you 🌸💕

Today's activity
29
5
0
Server overview
293Total members
7months old
16Age requirement
English Speaking Practice Discord server profile picture
English Speaking Practice
englishlanguagesocialcommunitylearningstudylanguageenglish practicechillhangoutfriendlysfwactive
Description

English Speaking Practice is a welcoming community dedicated to helping you improve your spoken English with confidence! 🌍✨ 💬 Practice speaking with people from around the world 🎮 Engage in fun activities like games and discussions 🎶 Share music, watch movies, and make new friends Join us to enhance your communication skills in a supportive and friendly environment.

Today's activity
12.6k
588
812
Server overview
116.5kTotal members
4years old
13Age requirement
Femboy Army Discord server profile picture
Femboy Army
фембойфембоиfemboyfemboysfemboilgbtgaytranstraptransgenderboykisserboyspridequeersissycrossdressingyaoibl
Description

Welcome to a cozy Discord server for femboys and their friends! 🌸 Enjoy a friendly atmosphere, chats, memes, gaming, and sharing interests. Join us to meet like-minded people and have a great time!

Today's activity
30.1k
328
258
Server overview
34.8kTotal members
6years old
13Age requirement
Roblox Rivals Discord server profile picture
Roblox Rivals
roblox rivalsroblox
user profile pic
guozhong054423-07-2026 09:58

な

Description

Join the #1 Roblox Rivals Discord Community and level up your gameplay! 🚀 We offer epic events, massive giveaways, LFG squads, clans, groups, and nonstop battles with active players every day. Roblox Rivals Discord Server — fan-made, highly active! If you are looking to imrove in roblox rivals, this is the place for you! Join us today and get better!

Today's activity
2.0k
327
49
Server overview
38.3kTotal members
2years old
13Age requirement
SoCal Locals Discord server profile picture
SoCal Locals
gaminghangoutfriendssan diegolos-angelessocalmeetupsriversidecalifornia
Description

This server was created to connect people in the SoCal region and beyond! This server offers: - Area-focused Community - Frequent Meetups - 18+ Members Only - Active Chat - Lively VCs - Fun Bots - THIS IS NOT a dating server

Today's activity
3.6k
60
4
Server overview
822Total members
11months old
18Age requirement
CS: Femboy Discord server profile picture
CS: Femboy
gaminglgbtfemboyfemboyslgbtq+csgocs2counter-strikecounterstrikeesportsfaceitlfg
user profile pic
acefrogge06-12-2024 02:13

:3

Description

LGBTQIA+-friendly Counter-Strike (CS2) community, whether you're looking for teammates or just people to talk to, come join us :3

Today's activity
426
82
18
Server overview
2.5kTotal members
3years old
14Age requirement
Duck Entertainment Discord server profile picture
Duck Entertainment
plextviptvembymoviesfilmseries
Description

🎬 Duck Entertainment - Premium Plex/Emby Share/Appboxes | 40K+ Movies | 400K+ Shows | 50K+ Anime | Bollywood [50% OFF ] 🎯  USE CODE Facebook 50% off 🔥 SPECIAL OFFER: 50% OFF for This week only code in the discord, located in the promo channel. 🔗 Join our Discord: http://discord.ducktv.ing Direct link to buy  https://shop.iduck.xyz/plex-emby-shares

Code is reddit Library Highlights: * 30,000+ Movies  * Growing 4K Library (20% of total movies & TV)  * 330,000+ TV Episodes  * 50,000+ Anime content  * XXX standard  * Hindi Bollywood  * Audio Books 330k * Music 3k Artist/ 1k Albums/ 30k Tracks add on  * Constantly updated with latest releases  Technical Specs: * 150Gbps connection  * 2.9PB+ of Ceph storage  * Global CDN for optimal streaming  * Transcoding enabled (except 4K content)  * Local storage  * 2 concurrent streams standard for tv  * Emby support available  * Live tv available  Features: * Trakt integration  * Custom collections  * Curated libraries (Trending, Popular, Holiday specials)  * Request system with bot  * Regular updates with new releases  * High-quality encodes  * App boxes available  * instant automated checkout  Support: * 24/7 via Discord, WhatsApp, Email  * Try before you buy available!  Payment Options: * PayPal  * Crypto  * Flexible plans (Monthly/Quarterly/Yearly)  * Bundle with tv and save  🔗 Join our Discord: https://discord.ducktv.ing Want to test drive our service? Join Discord for a trial! Questions? Drop them below! 👇 Note: Limited time offer, grab your spot while it lasts!
#Quality #Reliability #PremiumContent #Plexshare #Embyshare #Plexappboxes

Today's activity
45
11
0
Server overview
4.1kTotal members
5years old
13Age requirement
RS MEDIA Discord server profile picture
RS MEDIA
iptvplexembylive tvpremium iptvtrials availablesportsvodentertainment
Description

Your one stop shop for premium entertainment. We currently have 4 of the best private IPTV service to choose from. We also offer a wide selection of vod only services stremio and large plex, emby servers in 4k remux. Trials are available.

Today's activity
64
14
0
Server overview
291Total members
4months old
15Age requirement
F1 Discord server profile picture
F1
f1formula 1formula oneracingmotorsport
user profile pic
fduck107-09-2024 20:29

Sick!

Description

Join the ultimate F1 hub with IRL drivers and top content creators! Dive into live streams, race debates, and more!

Today's activity
339
168
3
Server overview
27.1kTotal members
6years old
13Age requirement
TDS Helpers Discord server profile picture
TDS Helpers
tdsgamesrobloxanime vanguardsanime guardianstdx
Description

We help people no matter what level, stage, or based on how good or bad they are at some TDS games on Roblox. If you need the extra helping hand just join and ask in our help channel and any helper or the owner will help you out and get your sorted and if you have a suggestion for a game that you think people might need help in just dm the owner and they will get back to you with a response!

Today's activity
11.7k
160
3
Server overview
5.1kTotal members
1years old
14Age requirement
Pink Heaven♡ Discord server profile picture
Pink Heaven♡
communitygamingfriendsrobloxmovieseventshorror13+
Description

♡‧₊˚Welcome to Pink Heaven‧₊˚♡
୨ ╭・─・─・─・─・─・─・─・─・─ ・୨୧ ˎˊ˗
♡┊‧₊˚ a wholesome & SFW community !
♡┊‧₊˚ a cute pink aesthetic layout
♡┊‧₊˚ voice chats & events
♡┊‧₊˚ horror, movies, + more
♡┊‧₊˚ gaming (Roblox, etc.)
୨ ╰・─・─・─・─・─・─・─・─・─・୨୧ ˎˊ˗
https://discord.gg/aHk8AxDEDJ

Today's activity
783
23
10
Server overview
1.5kTotal members
3years old
13Age requirement
Description

You can chat however you like on this channel: software coding channel, pictures, history, football, international chat, you can only chat in Croatian, it's an SFW server, swearing is forbidden, and other TOS rules apply

Today's activity
142
26
1
Server overview
1.1kTotal members
9months old
13Age requirement
Blox Fruits Trading Server | Trading & Stocks & Values Discord server profile picture
Blox Fruits Trading Server | Trading & Stocks & Values
bloxfruitstradingbloxfruitsbloxfruitbloxfruittradingserverbloxfruitsstockbloxfruittradesblox-fruitblox fruitbloxfruitsgiveawaysbloxfruithelpingrobloxgaming
Description

Welcome to Blox Fruits Community Server! The most active 24/7 trading & community server with live stock updates, legit free giveaways, and active traders. A player-prioritized space to trade safely, get help, and trade together. https://discord.com/invite/bloxfruitstradings

Never miss a stock rotation with dedicated live stock & alerts and real-time trackers. Enjoy a fast & safe trading environment to find W/L trades for high-tier items quickly and connect with active members. We frequently host legit giveaways and exciting rewards for the community, including free Devil Fruits and items.

Our space is strictly moderated and SFW, backed by active community helpers and moderators to ensure a safe trading system and assist you as quickly as possible. You can easily choose your notification preferences using customizable self-roles.

Join bloxfruitstradings 

Today's activity
501
147
2
Server overview
2.9kTotal members
9months old
13Age requirement
Moémon Official Discord server profile picture
Moémon Official
moemonpokemongbaromhackgamingcutepixelartanimeartfanartnds
Description

We are a dedicated community that makes cute Moémon sprites and mods for GBA games.

Today's activity
139
139
0
Server overview
39.3kTotal members
5years old
13Age requirement
Toxi's Paradise Discord server profile picture
Toxi's Paradise
socialespañolcomunidadserver en crecimiento
Description

¡Bienvenido a Toxi’s Paradise!

¿Buscas un lugar donde puedas ser tú mismo sin filtros?
¿Eres multifacético, rarito, hiperactivo, intenso, existencialista o simplemente diferente?
Entonces esta comunidad es para ti.

💥 Somos un servidor nuevo con hambre de crecer y crear conexiones reales.
🎙️ Hablamos de todo: música, filosofía, videojuegos, anime, creatividad, proyectos personales, shitposting sano y debates que te hacen cuestionar tu existencia.
🌐 Apoyamos a creadores de contenido, soñadores compulsivos, gente que escribe, dibuja, canta o simplemente piensa mucho.
🤝 Buscamos miembros activos, chill o con ideas locas. Aquí puedes brillar sin necesidad de encajar.
🎉 , roles, niveles, bots curiosos y gente que te caerá bien (Espero)

No somos solo un servidor. Somos un lugar donde las ideas raras florecen, donde habrán miles de proyectos e ideas revolucionarios o ¿Por qué no? ideas anti-revolucionarias
🔗 Únete. Es gratis. (El trauma también)

🧠 Toxi’s Paradise — Para los que no caben en ninguna parte… excepto aquí.

Today's activity
2.5k
17
0
Server overview
42Total members
1years old
16Age requirement
Auxcord Discord server profile picture
Auxcord
musiceventsspotifysocialchillgaytranslesbianaotylastfmlast.fmreviewrymfurrycommunity
Description

We love music! Come discuss songs and albums, participate in events, and enjoy yourself. LGBTQ+ and allies welcome!

Today's activity
7.1k
131
6
Server overview
5.5kTotal members
5years old
13Age requirement
Description

here at guardian angels we are a matchmaking server! It is not required to play the matchmaking game, you can join for our lovely community! If you're interested, here us how you play! Once you're in the server, you can create an introduction about yourself. Once you do, a Guardian will match you with someone! Whats the goal you may ask? To not fall in love! Ages 15+. Hope to see you there

Today's activity
449
40
1
Server overview
798Total members
1years old
15Age requirement
Best people Discord server profile picture
Best people
socialcommunitychillgaminggameshangoutfriendsfunchatfriendlyrobloxvcsfwmusicactiveminecraftmemesfortnitecreativeteenvoicechatfunnyhang out13-17vibesanimeroleplaylgbtq+
user profile pic
jerkmateworldchampion21-05-2026 06:52

Join up 🙏🙏

user profile pic
vip3rbox04-08-2026 18:29

JOIN UP WE IN VC

user profile pic
algi_goated04-08-2026 22:45

join

Description

🚀 JOIN THE VIBE | 1500+ DEEP 🚀
If you’re tired of dead servers, come thru to a pretty active hangout. We’re a Level 3 boosted social hub where we’re mostly just chilling, talkin in VC, and catching late-night vibes. When we aren’t just chatting, we’re running game nights for Siege, Roblox, and GTA V, and we even throw down on tournaments here and there to keep things competitive. We just hit 1500 members and we’re pushing for 2000 members—no toxicity, just chill people and good energy. Stop lurking and join the rotation!

Today's activity
4.0k
137
10
Server overview
2.5kTotal members
9months old
13Age requirement
Description

Streetwear • Fashion • Clothing Giveaways • Outfit Inspiration • Community Rewards • Creator Community. Join thousands of fashion lovers and win exclusive apparel.

Today's activity
3.4k
111
1
Server overview
8.5kTotal members
3years old
13Age requirement
Anime Sekai Discord server profile picture
Anime Sekai
animemangasocialvisual novellight novel
user profile pic
atomic_felix31-10-2024 17:21

hello <@943961278127423528>

Description

Brand new 16+ Anime, Manga, & Novels Server! 📚 Explore, chat, and make friends in a drama-free, welcoming community!

Today's activity
7.8k
106
5
Server overview
10.1kTotal members
3years old
16Age requirement
Mindbuilding Discord server profile picture
Mindbuilding
communitysocialchillhangoutchatactivevcprogrammingmental healthstudylearningsciencephilosophyhealtheducationstudyingstrategymbtiproductivitypsychologytypologylearnmotivationsmarthabitsacademicswellnessbrainiqfocusmindbig5memorysuccessself helpnootropicsself improvementgrowtheqself caregiftedtrainingmeditationcognitiongoalsknowledgebig 5mindbuildingintelligencemindsetcommunicationleadershippersonalityneurosciencebrain trainingoptimizationintellectual
Description

The #1 community for increasing intelligence through science-based mental exercises for IQ and cognition. Join to learn to max out IQ, EQ, focus, self-control, and mental strength. Become smarter and build mental fitness.

Today's activity
12.8k
172
7
Server overview
9.1kTotal members
2years old
13Age requirement
#bullshit 25+ Discord server profile picture
#bullshit 25+
socialchatchattingchillmake friends
Description

A 25+ social server for people that just want to meet new people, shoot the shit, and have a little fun

Today's activity
5.4k
101
2
Server overview
417Total members
5years old
25Age requirement
The Tavern (18+) Discord server profile picture
The Tavern (18+)
chessdrunkdrinkingfriendshipchillhangout
Description

The ultimate virtual house party for grown folks (18+). We have group videocalls going at all hours with chess, poker, karaoke, drinking games, and plenty of hanging out and chatting - just like you would at a bar where they take you in and soon, everyone knows you. Everyone is face-on-camera. We are alcohol, tobacco and marijuana-friendly, no hard drugs. Anxious or shy? Newcomers feel immediately welcome in The Tavern! - MUST be face on cam in our calls, no exceptions. Use phone with computer if needed for your cam (we provide instructions for Mac and PC). - MUST be an grown-up, speak English and be coherent and civil.

Today's activity
242
96
127
Server overview
17.5kTotal members
5years old
18Age requirement
CAT CULT 🐱 | 18+ Discord server profile picture
CAT CULT 🐱 | 18+
socialchillcommunityactivenitro
Description

Welcome to the Cat Cult - a polished & chill SFW 18+ server where you can make friends and talk about anything. Cats may be sacred, but the only thing we truly worship is good vibes! 🐱

Here’s what you’ll find:
💬 A relaxed, friendly community;
🙏 Chat about anything and everything;
🌟 Special roles, a custom tag, and leveling perks;
💎 Regular giveaways (Nitro, Gift Cards, Game Keys etc);
🍿 Occasional events and game nights;
💫 A space to be yourself, judgment-free.

Today's activity
7.0k
94
20
Server overview
1.6kTotal members
1years old
18Age requirement
Description

WayinVideo is an AI video platform that helps you work with long videos faster. You can use WayinVideo to help you understand or find highlight moments for social media clips, podcasts, interviews, webinars, livestreams, online courses, product videos, gameplay recordings, meetings, and other long-form video content. Our community is for creators who love turning long videos into powerful short content with Al. Share your clips, get feedback on your edits, and swap tips on using tools like Al Clipping, Find Moments, Video Summary, Al Subtitles, and Al- generated videos and more. Whether you re a YouTuber, editor, orjust getting startea, join us to discover, create, and share every social posts.

Today's activity
165
86
0
Server overview
30.5kTotal members
1years old
13Age requirement
The Spiritual Bodhi Cafe Discord server profile picture
The Spiritual Bodhi Cafe
weight losslose weightfitnessmounjaroozempic
Description

We are a SFW, 18+ weight loss server. We have all kinds of members, ranging from those on weight loss medications such as Mounjaro and Ozempic, to those who simply calorie count and practice mindful eating. Our goal is to be a place people look forward to visiting every day, somewhere they can share their struggles without judgement, and share their victories, no matter how big or small. To put it simply, this is a server for anyone who wants to lose weight safely and healthily. Whether you're just starting your journey, already finished and maintaining, or struggling to begin, you're welcome here.

Today's activity
134
11
0
Server overview
309Total members
2years old
18Age requirement
Verzuz Discord server profile picture
Verzuz
competitionbattlesaux battlesverzuz battlesmusic battlesmusicmusic community
Description

This is your exclusive hub to enjoy Verzuz-Like Aux Battles. You can participate using your favorite music artists (All Genres) or simply enjoy from the audience using exclusive stickers & emojis. ⭐A few example battles we've done.⭐ 🥊 2Pac Vs The Notorious B.I.G. 🥊 Twenty One Pilots Vs Fall Out Boy 🥊 Madonna Vs George Michael 🥊 WizKid Vs Burna Boy 🥊 Eminem Vs Kendrick Lamar We also do seasonal Awards including MVP, Rookie of the Season, Hall of Fame battlers, Ranking system, Cash Prize Tournaments, Battle profiles, Fun trash talking promos, and much more. Our server is active and fun. Come turn your fantasy match-up into reality.

Today's activity
13.2k
48
6
Server overview
118Total members
2months old
15Age requirement
Pokémon Champions | VGC Battles & Tournaments Discord server profile picture
Pokémon Champions | VGC Battles & Tournaments
gamingpokemonpokémonpokemon champions
Description

Pokémon Champions | VGC Battles & Tournaments

Find your next battle in a Pokémon Champions Discord focused on competitive VGC, team building and organised tournaments. Join players worldwide to test teams, exchange advice and prepare for your next best-of-three set.

▸ Find VGC Battles

Use battle pings to arrange BO1 games, BO3 sets and open team sheet practice. Find opponents on Pokémon Champions or Pokémon Showdown, test different leads and practise the matchups giving your team trouble. Prepare for ranked play and tournaments with other players who want useful practice.

▸ Build Stronger Teams

Share your team or Poképaste for feedback from experienced VGC players and community team builders. Discuss movesets, stat spreads, items, abilities, speed control and team synergy. Work through what each Pokémon contributes, which opponents cause problems and how to give your team a clearer game plan.

▸ Review Replays & Improve Decisions

Share a close set, a difficult loss or a turn you were unsure about. Review positioning, switches, target choices, Protect timing and endgames. Compare possible plays and discuss how to adapt between games in a BO3.

▸ Compete in Community Tournaments

Enter Pokémon Champions tournaments and organised competitive events. Find registration links, formats, rules, team sheet requirements, schedules and results. Use tournament discussion and practice channels to prepare, ask questions and connect with other competitors.

▸ Explore Draft Leagues

Plan your picks, develop your roster and prepare for scheduled opponents. Dedicated draft channels cover resources, team discussion, match coordination and results. Learn how to build around your available Pokémon and adjust your strategy for each matchup.

▸ Connect With the VGC Community

Discuss current regulations, tournament teams and strategies including Trick Room, Tailwind, weather and terrain. Explore guides, sample teams and battle resources. Meet Nintendo Switch and mobile players, ask setup questions and connect through global chat, Pokémon trading and community giveaways.

New to competitive doubles? Ask questions and learn the fundamentals. Already competing? Find practice partners, exchange ideas and help other players improve.

The community is SFW, and VGC is our shared focus. Bring a team to test, a replay to review or a matchup you want to understand.

Join Pokémon Champions:
https://discord.com/invite/pokemon-champions-1457350549216432295

Guides and resources:
https://pokemonchampionsdiscord.com/

Today's activity
8.7k
277
9
Server overview
5.6kTotal members
8months old
13Age requirement
Fluid Client Discord server profile picture
Fluid Client
communitysocialactivechillroleplaygaminghangoutgamescreativefriendsfunfriendlyartchatmusicvcsfwrobloxminecraft
Description

Ready to take your Minecraft adventures to the next level? Fluid Client, the unrivaled Minecraft client for 1.8.9, is your ticket to endless possibilities! 🌍 Unleash your imagination, conquer challenges, and build your way to victory! Download now at https://fluidclient.ovh/download.

Today's activity
8
6
0
Server overview
9.4kTotal members
3years old
13Age requirement
Description

"You'll face death, and it won't be pretty.
Enough death to leave your broken, time and time again...."

Congratulations! The application you submitted to become a part of Project Epsilon has been accepted! Welcome aboard!

Hello and a warm welcome to Halo: Project Epsilon! This is a server where you take the role as an agent of Epsilon. You will embark on a whole variety of missions to various ancient and fantastical planets (created by yours truly) to combat the rising power of the evil Red Talon corporation. While working alone in this server is plausible, it is also foolish. We here at Epsilon are huge advocates for teamwork as it not only improves overall RP experience, but it also leads to more interesting and diverse scenarios for you and your new friends to enjoy. You heard me right, friends! Epsilon gladly welcomes anyone of any race, culture, background or identity, regardless of whether or not you are a member of the LGBTQ+ or if you are just an 8ft tall Sangheili, we are all friends here!

This is based on Red VS Blue’s project freelancer and is a custom rp server that involves:
- Team based mission RP 🕴️
- A competitive leaderboard to flex on all your pals 💪
- Frequent and inclusive events (nitro) 🫨
- Friendly staff who will be your new best friends 😎
- Acceptance of everyone, unless you are from Formby, which case I want my money back 🏳️‍🌈
- POKECORD 🦆
- Comedy 🤓
- Women (I think)🤷
- HUNGER GAMES! 🕺
- CQ Cumber 🐐
So if you like what I described and you think this server fits your vibe. Join! I would love to see you there and so would everyone else. If you still have any questions then all you got to do is ask me or our dedicated staff team (I love them) who will gladly offer assistance to solve any quibbles and quabbles you may have. I truly hope to see you there.

-Colorado

Today's activity
12
5
0
Server overview
119Total members
6years old
13Age requirement
Komi Cafe Discord server profile picture
Komi Cafe
animesocialcommunityvcchillgaming
Description

.·:¨༺ ༻¨:·. ✧. ┊ Hello, Oshi No Ko and Komi Can't Communicate fans, including many others! We introduce you.. to Oshi No Komi Café, a place that goes above and beyond to reach the stars! ★ ⋆ Are you hoping to find a comfy server to relax, make friends, chill, and game in? Are you an artist, writer, voice actor, or vtuber? Maybe even all? Then, our server is an absolutely perfect place for you to lounge in! ⋆ ★ ✧. ┊  Well, you might be wondering, "what does this server offer?" And we're here to tell you, we offer tons of things, in fact! All of which we're sure you'll come to love! .·:¨༺ ༻¨:·. .・。.・゜✭・.・✫・゜・。. ☕ ✧ ﹕ A laid-back, active community! 🥞 ✧ ﹕ Tons of emotes, both cute and funny! 🍵 ✧ ﹕ An aesthetic and cute café theme for you to enjoy! 🧇 ✧ ﹕ Lots of ACNH related activities, giveaways, events, and more! 🍪 ✧ ﹕ Server currency, to use as you please! 🥐 ✧ ﹕ Multiple channels for your interests! 🥛 ✧ ﹕ A listening owner and staff team! 🥯 ✧ ﹕ Fun, warm, and welcoming members! 🍞 ✧ ﹕ Level 3 boost! .・。.・゜✭・.・✫・゜・。. ✧. ┊ We hope to see you soon, we promise we'll welcome you warmly! ☆ ˚  ·    . ☆ Ready to reach the stars?・・・ ( https://discord.gg/bbchxy3rHZ ) ☆ ˚  ·    . ☆

Today's activity
246
14
0
Server overview
5.8kTotal members
4years old
13Age requirement
Skin Advice Discord server profile picture
Skin Advice
accutaneacnebeautychillcommunityfitnessfriendlyfungymhangoutlgbtq+makeupmentalhealthmusicpimplesselfcaresfwskincaresocial
user profile pic
manishon21-09-2024 21:28

Love yourself!

Description

。゚゚・。・゚゚。 ゚。 ✴ Skin Advice ✴  ゚・。・゚ ➜ Hey fellas! ❇ This is a server dedicated for people who are into skincare and makeup/fashion! we also provide all sorts of channels for other topics! ❇ We have a simple welcoming aesthetic theme ❇ Non toxic and LGBTQA+ friendly ❇ Self roles for more customization ❇ And much much more things (you can drop your suggestions too!) ☯ What are you waiting for? Come and join us!

Today's activity
562
74
0
Server overview
10.2kTotal members
4years old
13Age requirement
🍂 Autism Day Café 🎃 Discord server profile picture
🍂 Autism Day Café 🎃
socialchillgaminggamesfriendlyvclgbtq+18+eventsgaycozytransqueertransgender
Description

A server for adults without petty drama or toxicity. We're chill, wholesome and NOT nsfw focused!

🏳️‍🌈 Very LGBTQ friendly
🎉 Events including game- and movie nights
🗣️ Discussions about games, movies, anime etc.
👋 A welcoming community with positive vibes!

(We have a big LGBTQ community but you don't have to be LGBTQ to join)

We hope to see you soon! c:

Today's activity
886
73
1
Server overview
575Total members
6years old
18Age requirement
FUßgängerzone Discord server profile picture
FUßgängerzone
gamingminecraftsocialgermandeutschleagueoflegends
Description

🎮Hallo und Willkommen!

Wir sind ein neuer Server und freuen uns über jeden, der Teil unserer Community werden möchte. Bei uns steht der Spaß im Vordergrund – egal ob Zocken, Quatschen oder einfach nur Chillen.

🦶 Wir haben einen Füße Server Tag den Ihr frei nutzen könnt.

⛏️ Außerdem haben wir einen eigenen Minecraft-Server. Um dort mitzuspielen, benötigst du eine Whitelist, die du dir auf dem Discord holen kannst.

💎 Server-Booster können sich eine eigene Custom-Rolle mit Wunschfarbe und Namen erstellen.

Wir sind nicht übertrieben streng. Ein bisschen gegenseitiges Necken oder Beleidigen ist okay, solange niemand dadurch verletzt oder gezielt angegriffen wird. Respekt voreinander ist uns trotzdem wichtig.

Komm vorbei, mach es dir gemütlich und werde Teil der Fußgängerzone! 🚶‍♂️✨

Today's activity
6.0k
70
16
Server overview
244Total members
3months old
13Age requirement
[CGT]Cossack's Gaming Team Discord server profile picture
[CGT]Cossack's Gaming Team
gamingcommunitypolskagraniegraczpc
Description

Cossack's Gaming Team – Dołącz do Naszego Community! Cossack's Gaming Team to przyjazne, notoxic i otwarte community 18+, które zrzesza już ponad 2500 osób. Jeśli szukasz miejsca, gdzie gaming łączy się z pasją i dobrą zabawą – to jest miejsce dla Ciebie! 🕹 Co znajdziesz u nas? 🔸 Kanały tematyczne – gamingowe i nie tylko (sport, kino, rozrywka). 🔸 Rozbudowana infrastruktura serwerów i społeczności. 🔸 Własne serwery Hell Let Loose oraz CS2. 🔸 Turnieje, eventy, meetingi i zloty – bawimy się razem online i offline! 🔸 Giveaway’e i gadżety klanowe – avatary, merch i więcej. 🔸 Streamerzy – wspieramy naszych twórców treści!

Today's activity
769
69
47
Server overview
2.4kTotal members
6years old
18Age requirement
Minecraft Building | ShapeWorks Discord server profile picture
Minecraft Building | ShapeWorks
minecraft-javaminecraft-serverminecraft-bedrockminecraft-buildsminecraft-worldsminecraft-creativecreative modebuildingminecraft-buildingminecraft
Description

꧁༺ 𝓼𝓱𝓪𝓹𝓮𝔀𝓸𝓻𝓴𝓼 ༻꧂
︶꒷︶꒦︶︶꒷︶꒦︶︶꒷︶꒦︶
༺ GOOD BUILDERS only!༻
We've gathered the best builders of Minecraft in 1 discord server!
────────↬↫────────
➤ OFFICIAL MOJANG PARTNER
↣ We'll teach you how to build; build academy/education, competitions, commissions and promotions.

↣ Our server is 100% meant for building; tools such as FA-WorldEdit, VoxelSniper, Gobrush, GoPaint, and many more...

↣ Get a chance to work with an OFFICIAL MARKETPLACE Partner

────────↬↫────────
You can Commission the best builders in Minecraft here!
────────↬↫────────

ঔৣ☬***JOIN the Build-SERVER***☬ঔৣ

༺IP: sw.duckmc.net༻
༺Port: 25613༻
────────↬ ↫────────

↬FOR BUILDERS, RAN BY BUILDERS↫

Today's activity
456
123
1
Server overview
7.2kTotal members
8years old
14Age requirement
♡ The Hangout ♡ Discord server profile picture
♡ The Hangout ♡
communityhangoutgiveawayslgbtsafe spaceliveboredhangtag
Description

Welcome to the hangout, a safe space for the LGBTOIA+ community and allies. Enjoy your stay and have fun! This server is 13+, but we do have an 18-plus area; you need to be verified to access it. We also have a cute HANG Heart tag that you can display on your profile.

Today's activity
40
33
0
Server overview
1.9kTotal members
1years old
13Age requirement
Burn Book 25+ Discord server profile picture
Burn Book 25+
2525+3030+4040+socialgamingdead by daylightfortniteover 30
Description

💖Welcome to Burn Book 25+💖 A 25+ server! Ready to write your entry in the burn book? 🌟Inclusive community 🌙 Laid back staff 🌟Movie / game nights 🌙 Opt- in channels and pingable roles 🌟Frequent voice chatters 🌙Booster Perks

Today's activity
1.0k
49
0
Server overview
329Total members
4months old
25Age requirement
StarWars: RP Discord server profile picture
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
1.1k
38
1
Server overview
338Total members
4years old
16Age requirement
Clippers HQ Discord server profile picture
Clippers HQ
clipsclipclipperclipperscreative
user profile pic
andrewthegoat_107-08-2025 17:45

Join up

Description

✂️ Join Our Private Clipping Network We connect skilled editors with influencers who need viral short-form content. You focus on editing we handle the rest.

Today's activity
107
24
0
Server overview
7.3kTotal members
1years old
13Age requirement
Grotesque Discord server profile picture
Grotesque
horrormoviesfilmscommunity18+
Description

Are you obsessed with horror? Do you love the weird and wonderful? We are the bizarre and embrace those who love horror, true crime, the paranormal and movies in general. We welcome all of you out there looking for a server to fit in.

Today's activity
514
27
0
Server overview
1.3kTotal members
6years old
18Age requirement
Precision Peptides Discord server profile picture
Precision Peptides
fitnessgympeptidepeptidesweight loss
Description

Precision Peptide is a trusted source for premium-quality research peptides, dedicated to supporting scientific innovation through exceptional product quality and reliable service. We provide carefully sourced peptides that undergo rigorous quality control to ensure purity, consistency, and accuracy for laboratory and research applications. Our commitment to transparency, fast order processing, and secure packaging allows researchers to focus on their work with confidence. Whether you're conducting academic studies, biotechnology research, or pharmaceutical development, Precision Peptide aims to be a dependable partner by delivering products that meet high industry standards. We continuously strive to improve our catalog and customer experience while maintaining professionalism and integrity in everything we do. At Precision Peptide, precision isn't just our name—it's the foundation of our commitment to advancing scientific research with dependable products and outstanding support.

Today's activity
40
21
0
Server overview
473Total members
2months old
13Age requirement
SERIEN  ᡣ𐭩 •。ꪆৎ ˚⋅ Discord server profile picture
SERIEN ᡣ𐭩 •。ꪆৎ ˚⋅
friendscommunitygaminglgbtqanimeart
Description

A fun, welcoming, and cute server where you can make friends, play games, and be part of an active community! We’re a creative and lively space for creating friends, playing games and hosting giveaways, please enjoy your stay with us <33

Today's activity
14
3
0
Server overview
58Total members
8months old
13Age requirement
𝐋𝐚𝐰𝐥𝐞𝐬𝐬 Discord server profile picture
𝐋𝐚𝐰𝐥𝐞𝐬𝐬
freakyunhingedhangoutchaoticchill
Description

A server created for the sole reason of harboring unhinged and freaky mfs to roam around like outlaws. There's no reason to deny that it is indeed made to be a shithole with almost a hint of wholesomeness. Almost. So join in, thug out the beef and indulge in the toxicality. Contact the owner if you have an issue.

Today's activity
2.5k
74
1
Server overview
2.6kTotal members
1years old
13Age requirement
FIRESIDE Discord server profile picture
FIRESIDE
communitysocialgamingvcsportsoutdoorsfashion
Description

FIRESIDE offers a seat around the virtual fire for folks whether they are seeking out a place to discuss sports, encourage fitness goals, post their latest outdoor adventures, play video games, watch movies or television shows together, drop their latest fashion pick ups, or are just looking for a spot to make new friends.

Today's activity
794
55
13
Server overview
1.1kTotal members
7years old
18Age requirement
Helldivers 2 España Discord server profile picture
Helldivers 2 España
videojuegosespañaamistad
Description

Servidor para la comunidad de España de Helldivers 2. Diseño muy sencillo y directo al grano. ¡Echa un vistazo!

Today's activity
79
7
5
Server overview
38Total members
4months old
16Age requirement

952 servers found