Roleplay Discord servers

🔎 Search
🏷️ Tags
🔞 Age Requirement
📊 Sorting
👥 Server Size
📅 Server Age
🌍 Language
🎭 Vibes

207 servers found

Taxlandia Discord server profile picture
Taxlandia
polsimsocialcompanyroleplayrpsim
Description

You join as nobody. Pay taxes or get kicked. Find work, climb ranks, or go underground. CORPORATE SOCIETY is a living Discord sim where an AI governs a real company, with departments, politics, promotions, and a rival faction trying to burn it down.

Today's activity
48
6
0
Server overview
9Total members
1months old
13Age requirement
DO UNTO OTHERS. ♰ Discord server profile picture
DO UNTO OTHERS. ♰
roleplayfantasyocswerewolvesvampirescult
Description


Are you tired of feeling lonely, lost, and afraid? Ready to give up and place your life in the hands of hunters who seek to snuff out your life force?

Well, feel afraid no more, dearest lamb, you’ve picked up the right brochure. Here at Sacred Heart Chapel & Monastery, we pride ourselves on building a family for those who have lost their way. Not only are we a place of worship, but we're also a place of love, ready to accept anyone in need. No matter their sins, everyone deserves a safe place.

✞✞✞✞

DO UNTO OTHERS is a Discord roleplay server taking place in 1990, just outside of Montreal, Canada, in the suburban, HOA-run Greenbridge Township, famously known for its extreme normalcy. During the day, townsfolk wander the streets, participating in various activities such as grocery shopping, morning jogs, barbecues, and house painting, completely oblivious to the creatures lurking in the woods around them. At night, however, the quiet church in the center of the town bustles with the supernatural, hailing praise to their cult leader and god, Father Cleopatra Sinclair.

Will you join the cult, pursue a normal life, or maybe join the forces trying to tear down the walls of the church? The choice is yours, so choose carefully.

We offer various things such as:
✞ An immersive roleplay world for you to explore with live events, world news, etc.
✞ Detailed different species for you to play as.
✞ A Friendly, inclusive, lgbtq+ space. That DOESN'T promote censorship.
✞ 17+ members
✞ Staff who are always available to help with anything you need.

.... And Much more!
So, join us today, and invite your friends! We'd love to have you!

xoxo,
DO UNTO OTHERS staff team ✞

Today's activity
193
10
0
Server overview
46Total members
5months old
17Age requirement
Echoes of Crystal Discord server profile picture
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
1.9k
22
8
Server overview
140Total members
2years old
14Age requirement
It's Your Power! Discord server profile picture
It's Your Power!
roleplayrpmhamy hero academiamha-rproleplayingmy hero academia-roleplay)my hero academia-rppartnership
Description

🌟 IT’S YOUR POWER! — MY HERO ACADEMIA RP 🌟

🦸‍♂️ Do you have a hero OC?
🦹 A villain with a cause?
👤 Or a civilian just trying to survive in a superpowered world?

It’s Your Power! is a My Hero Academia–based roleplay server set in a post-war, hybrid timeline, where hero society is rebuilding—and redefining itself.

In this world, most humans possess Quirks, superhuman abilities that shape daily life, careers, and conflict. Hero schools still stand, villains still lurk, and the line between right and wrong has never been thinner.

What sets us apart?

✨ Play who you want.
You’re not limited to hero students. Play:
Hero students, Pro Heroes, Villains, Vigilantes, Civilians, Support and business roles
…and more.

🏫 Multiple Hero Schools

U.A. High School

Shiketsu High School

Deika City University (DCU) — a bold, experience-first hero institution

📖 Story-Driven World
The world reflects the consequences of canon events, while leaving room for player-driven stories, growth, and server-wide arcs.

🌈 Inclusive & Community-Focused
Whether you’re here for intense plots, character development, or casual RP, there’s a place for you.

🔹 What We Offer:

• Friendly and welcoming community
• Clear rules and active staff
• Self-assignable roles
• Open RP channels (no forum locking)
• RP events and story arcs
• LGBTQ+ friendly environment
• Unlimited original characters
• Canon characters available to claim
• Partnerships welcome

Step into a world where power doesn’t define destiny.

It’s not about the Quirk you’re born with.
It’s about what you choose to do with it.

💥 It’s Your Power! 💥

Today's activity
2.9k
30
0
Server overview
199Total members
5months old
15Age requirement
Description

"You'll face death, and it won't be pretty.
Enough death to leave your broken, time and time again...."

Congratulations! The application you submitted to become a part of Project Epsilon has been accepted! Welcome aboard!

Hello and a warm welcome to Halo: Project Epsilon! This is a server where you take the role as an agent of Epsilon. You will embark on a whole variety of missions to various ancient and fantastical planets (created by yours truly) to combat the rising power of the evil Red Talon corporation. While working alone in this server is plausible, it is also foolish. We here at Epsilon are huge advocates for teamwork as it not only improves overall RP experience, but it also leads to more interesting and diverse scenarios for you and your new friends to enjoy. You heard me right, friends! Epsilon gladly welcomes anyone of any race, culture, background or identity, regardless of whether or not you are a member of the LGBTQ+ or if you are just an 8ft tall Sangheili, we are all friends here!

This is based on Red VS Blue’s project freelancer and is a custom rp server that involves:
- Team based mission RP 🕴️
- A competitive leaderboard to flex on all your pals 💪
- Frequent and inclusive events (nitro) 🫨
- Friendly staff who will be your new best friends 😎
- Acceptance of everyone, unless you are from Formby, which case I want my money back 🏳️‍🌈
- POKECORD 🦆
- Comedy 🤓
- Women (I think)🤷
- HUNGER GAMES! 🕺
- CQ Cumber 🐐
So if you like what I described and you think this server fits your vibe. Join! I would love to see you there and so would everyone else. If you still have any questions then all you got to do is ask me or our dedicated staff team (I love them) who will gladly offer assistance to solve any quibbles and quabbles you may have. I truly hope to see you there.

-Colorado

Today's activity
9
4
0
Server overview
127Total members
6years old
13Age requirement
The Russian Language Discord server profile picture
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
4.3k
75
15
Server overview
6.6kTotal members
5years old
13Age requirement
Furry Valley Discord server profile picture
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
1.9k
42
10
Server overview
12.4kTotal members
9years old
13Age requirement
Rus' | Into The Frost Discord server profile picture
Rus' | Into The Frost
adventurefantasymedievalroleplay
Description

With a long winter preparing to encapsulate the Tsardom of Rus' and all living things within the Russkaya Zemlya, we invite you to join us in the new and improved Rus' Universe. Dobro pozhalovat' v Rus! Welcome to the Rus', my friend. The "Rus' | Into The Frost" is a server based on 15th-Century Medieval Russia with a fantasy twist. Imagine a world where legendary creatures found in traditional folklore coexisted alongside ManKind. It is in our universe that adventurers from all corners of the globe travel to the Land of the Rus' to test their mettle against the ferocious beasts that dominate the cold lands. Limited by only your own brilliant creativity, you are allowed to start off as a majestic and nimble Kitsune from the Far East—using magic to turn your foes to dust. You can even try to slay beasts as an Elven Archer from the Germanic Region who can strike down their prey from miles away, a werewolf, vampire, orc, and so much more. Don't be afraid to strive for whatever your artistic mind desires. This is a community that accepts all passionate to write, role-play, and help build an immersive universe influenced by its members and everything we do as a community. Upon joining, we ask that you take the time to read the instructions provided in our welcome channel. We are a very well-written and fleshed-out server. We hope that you'll be joining us very soon on our courageous adventures, friend.

Today's activity
33
8
0
Server overview
42Total members
3years old
18Age requirement
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
413
17
0
Server overview
1.1kTotal members
5years old
15Age requirement
The Writer's Library {{21+ RP Hub}} Discord server profile picture
The Writer's Library {{21+ RP Hub}}
friendlysocialroleplayrpcommunitywritingroleplayerroleplay partnerwritersactive
Description

Welcome to the Writers Library. All writing levels are welcome! We are a 21+ Role Play server. We do request your work be human written. Here you can find yourself lost in the pages of your own creations and meet other writers to join you.

Today's activity
1.8k
45
0
Server overview
296Total members
9months old
21Age requirement
The Starry Justice Show! (Arc 2) Discord server profile picture
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
1.1k
31
1
Server overview
277Total members
2years old
13Age requirement
StarWars: RP Discord server profile picture
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
972
36
2
Server overview
310Total members
4years old
16Age requirement
City in the Sky Discord server profile picture
City in the Sky
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
958
50
0
Server overview
2.8kTotal members
1years old
13Age requirement
Monarch's Domain Discord server profile picture
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
785
22
13
Server overview
1.3kTotal members
3years old
13Age requirement
Girls Frontline: Mercenaries Discord server profile picture
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
192
13
0
Server overview
204Total members
3years old
13Age requirement
Description

𝐒𝐄𝐕𝐄𝐍.. 𝐒𝐈𝐗... 𝐄𝐋𝐄𝐕𝐄𝐍... 𝐅𝐈𝐕𝐄... 𝐍𝐈𝐍𝐄 𝐀𝐍' 𝐓𝐖𝐄𝐍𝐓𝐘 𝐌𝐈𝐋𝐄 𝐓𝐎-𝐃𝐀𝐘... 𝐅𝐎𝐔𝐑... 𝐄𝐋𝐄𝐕𝐄𝐍.. 𝐒𝐄𝐕𝐄𝐍𝐓𝐄𝐄𝐍.. 𝐓𝐇𝐈𝐑𝐓𝐘-𝐓𝐖𝐎 𝐓𝐇𝐄 𝐃𝐀𝐘 𝐁𝐄𝐅𝐎𝐑𝐄..

⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆
est. 7th November 2023. The most long lasting, active vibey aot rp server you'll ever find. **SERVER TAG + EXCLUSIVE ROLES!!** ( and 24/7 poketwo)

Interested in joining a chill out aot rp server on disc thats also active, with amazing and hilarious (and actual NON toxic) members? This server supports all styles of RPing. Here's why you should join:
╰┈➤There are SO many available canon characters to choose from, (and by choosing a canon, you're also guaranteed a unique role, [yes- even the "minor side characters"] no service required!) and we LOVE OCs!! There are many activities that take place including royal balls/galas, battles, path sequences and so much more.. and even an actor au! ╰┈➤The server allows you to focus on your character as well as their interactions with others. NO ONE is ever left out in the plot.
╰┈➤Choose where your character comes from (if an OC) I.E Marleyan or Eldian. There are loads and loads of different channels, (including Marley, beyond the walls, and more!) This server also doesn't have an over-the-top combat system or rules, you can go crazy! (just not OP.)
╰┈➤The plot has a perfect balance of comedy, combat, romance, serious RP and many tear jerking moments.
╰┈➤ This server is perfect for any RPer who is just starting out, getting back into the fandom, or just wants a chance to show off some writing. But wait, there's more!
╰┈➤ We don't just do RP here. We have regular silly VC's, music nights, game streams, UNO, and many more! With that said, thank you so much and I know we'll all be able to give eachother a memorable RP experience!
⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆

𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒... 𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒.. 𝐌𝐎𝐕𝐈𝐍' 𝐔𝐏 𝐀𝐍' 𝐃𝐎𝐖𝐍 𝐀𝐆𝐀𝐈𝐍.. 𝐓𝐇𝐄𝐑𝐄'𝐒 𝐍𝐎 𝐃𝐈𝐒𝐂𝐇𝐀𝐑𝐆𝐄 𝐈𝐍 𝐓𝐇𝐄 𝗪𝐀𝐑.

Today's activity
4.0k
59
5
Server overview
606Total members
2years old
13Age requirement
Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang Discord server profile picture
Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang
communitysocialchillgamingroleplaygameshangoutfriendsfunfriendlychatmusicactiveminecraftrobloxrpfortnitegiveawaysprogrammingvalorantenglishchattingyoutubenitrolanguagediscordlearningminecraft-servergiveawayminecraft-javaespañolpcpokemongaming-communitywelcomingsupportvoice chatserveractive-communitytradingrobuxcryptospanishfrencheuropepvpnewsgamerspromotradehacksamericacryptosignalsbitcoindaytraderkemeticgermangermanymetin2yangbuym2tradecentermetin2tradermetin2pvpmetin2wonbuymetin2yangbuysmetin2yangbuygermaniametin2yangbuyiberiametin2metin2tradecenterm2trademetin2yangbuyeuropemetin2yangbuyitaliamt2trademetin2tradeusdtmetin2yangmetin2germaniawonbuymetin2teutoniawonbuymetin2teutoniayangbuymetin2teutoniayangkaufenmetin2teutoniawonkaufenmetin2 europe yang buymetin2 europe yangmetin2 italia yang buymetin2 iberia yang buymetin2 tigerghotmetin2 tigerghost yang buymetin2 tigerghost won buymetin2 tigerghost yang kaufenmetin2 tigerghost won kaufenanimemetin2 romania yang buymetin2 romania won buymetin2 ruby kirin won buymetin2 ruby kirin yang buymetin2tr yang satinalmetin2tr won satinalmetin2tr yangmetin2pvp yang satinalmetin2pvp yang buymetin2pvp won buy
user profile pic
metin2.yang13-05-2026 00:53

hi

user profile pic
guardwon13-05-2026 00:56

Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang! Metin2 Global/Official Won/YANG FAST DELIVERY Safe Trade Discord Add : metin2yang 👽-;----FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #Metin2 won buy #Metin2 won farming #buy Metin2 won #Metin2 won guide #how to buy won #Metin2 won tips #Metin2 won making #Metin2 won selling #cheap Metin2 won #Metin2 won tutorial #Metin2 won scams #Metin2 won market #Metin2 won tricks #Metin2 won 2025 #Metin2 won s

Description

Metin2TradeCenter Group 2027 Won/YANG FAST DELIVERY Safe TradeDiscord Add : metin2yang 👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #wonbuy #wonsell #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #metin2yangbuy #dragoncoins #Metin2yangkaufen #sell #metin2tradecenter #buy #tradecenter Metin2 Global/Official Won/YANG FAST DELIVERY Safe TradeDiscord Add : metin2yang👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #Metin2 won buy #Metin2 won farming #buy Metin2 won #Metin2 won guide #how to buy won #Metin2 won tips #Metin2 won making #Metin2 won selling #cheap Metin2 won #Metin2 won tutorial #Metin2 won scams #Metin2 won market #Metin2 won tricks #Metin2 won 2025 #Metin2 won strategies #Metin2 won farming guide #Metin2 won leveling #best Metin2 won #Metin2 won offline shop #Metin2 won alchemy #RubyChimera #RubyKirin #Azrael #Tigerghost #Metin2pvp #Metin2pvm #Metin2p #Metin2.de #Metin2.ro #Metin2.en #Metin2it #Metin2.ru #Metin2.us #Metin2.uk #Metin2.pl #Metin2.cz #Metin2.hu #Metin2.ar #Metin2.ae #Metin2.ea #Metin2.es #Metin2.pt #Metin2.gb #Metin2.ar #Metin2.co #Metin2.co #Metin2.mc #Metin2.mx #Metin2.pe #Metin2.fr #Metin2.magyar #Metin2.br #Metin2.tr #Metin2tr #Metin2.germania #Metin2Teutonia #Metin2Europe #Metin2.eu #Metin2Marmara #Metin2.west #metin2west #Metin2Dandanakan #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter

Discord Add : metin2yang👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy Metin2Tradecenter Private-gameforge-official Won-YANG discord: metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #dragoncoin #metin2tradecenter #tradecenter #wonkuanfen #tigerghost #tigerghostwonbuy #mt2tradecenter #metin2

Today's activity
290
35
1
Server overview
6.0kTotal members
5months old
18Age requirement
The Funnybunny Street Corner (21+) Discord server profile picture
The Funnybunny Street Corner (21+)
tadctadc rpthe amazing digital circusroleplaythe amazing digital circus rp
Description

WE ARE NEW! A 21+ roleplay server aimed towards people who wanna write and have fun! Here you'll find NPCs, OCs, partnerships, and game nights with friends! We have literate and crack roleplay channels as well as places to post all your wonderful media!

TAKEN CHARACTERS:
JAX
CAINE
POMNI
EVIL JAX

6 OC SLOTS OPEN!

COME JOIN AND BECOME THE DIGITAL DISASTER YOU WERE MEANT TO BE.

Today's activity
236
12
6
Server overview
37Total members
2months old
21Age requirement
𝗗𝟰 Discord server profile picture
𝗗𝟰
communitysocialchillgamingroleplaygameshangoutanimefriendsfunfriendlyartchatmusicactiverobloxvcsfwminecraftlgbtq+memesmangarpeventspoliticsvaloranthorrorenglishnon-toxicprogramminganime rpaireading13+egirlslgbtqcatslgbtq friendlyteenactive-communitysportstechnologyfootballvoice chatnontoxicgamersbooksmusic producersegirlbookclubcutegtaadultsvoice-chatemojiartsmusicianteensgoofyweedactive-voicechatsmoking420gamerapexteen-friendlyhouse of the dragonanime rpgvcsemojisfun factsgame nightsvaporwavetechnicallgbtq+ friendlygame-devraidsno toxicitygta vdevelopershang outpersonal developmentmusic botsemoclassical musiceboystomb-raidersoccerstorytechlgbt friendlysocial community vc fun friendlyraidingskateboardinggamer-girlsweebnukevapingeboyd4gamer-girlskatingscooteractive voice chatraiderssk8stonervaporprogrammersskatergamergirlpartnershippartnershipspartnerpvppcskateskateboardskawritingmoviemovie nightmoviesmovie nightsfilm
Description

𝗗𝟰 𝗶𝘀 𝘁𝗮𝗶𝗹𝗼𝗿𝗲𝗱 𝘁𝗼 𝗮𝗹𝗹 𝗽𝗲𝗼𝗽𝗹𝗲 𝘄𝗵𝗼 𝗷𝗼𝗶𝗻.
● sғᴡ → ᴀʀᴛ
● ᴛᴇᴄʜ → ᴀɴɪᴍᴇ
● ᴍᴜsɪᴄ → ᴍᴇᴍᴇs
● ᴇᴠᴇɴᴛs → sᴏᴄɪᴀʟ
● ᴀᴄᴛɪᴠᴇ → ᴠᴀᴘᴇʀs
● ᴇ-ʙᴏʏs → ʜɪᴘᴘɪᴇs
● ɢᴀᴍɪɴɢ → ᴇ-ɢɪʀʟs
● sᴋᴀᴛᴇʀs → sᴛᴏɴᴇʀs
● ᴇǫᴜᴀʟɪᴛʏ → ᴀᴛʜʟᴇᴛᴇs
● ᴍᴜsɪᴄɪᴀɴs → sᴛʀᴇᴀᴍɪɴɢ
● ʀᴀᴘ-ʙᴀᴛᴛʟᴇs→ ɴᴏɴ-sᴛᴏɴᴇʀs
● ᴘʀᴏɢʀᴀᴍᴍɪɴɢ → ᴄʏʙᴇʀ-sᴇᴄᴜʀɪᴛʏ
● ᴄᴀᴛᴄʜɪɴɢ-ᴘᴇᴅᴏs → ғʀᴇᴇ-ᴇxᴘʀᴇssɪᴏɴ
● ᴀɴᴛɪ-ᴄᴏʀʀᴜᴘᴛɪᴏɴ → ᴍᴜsɪᴄ-ᴘʀᴏᴅᴜᴄᴇʀs
● ᴄᴏɴᴛᴇɴᴛ -ᴄʀᴇᴀᴛᴏʀs → ᴘᴏᴇᴛʀʏ ᴀɴ ǫᴜᴏᴛᴇs
𝗧𝗵𝗲 𝗽𝗲𝗿𝗳𝗲𝗰𝘁 𝗽𝗹𝗮𝗰𝗲 𝗳𝗼𝗿 𝗺𝗲𝗲𝘁𝗶𝗻𝗴 𝗻𝗲𝘄 𝗽𝗲𝗼𝗽𝗹𝗲 𝗲𝘃𝗲𝗿𝘆𝗱𝗮𝘆.

NON-TOXIC

Today's activity
207
33
11
Server overview
768Total members
1years old
13Age requirement
Puella Magi: Maeror Magica Discord server profile picture
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
30
5
0
Server overview
166Total members
4years old
15Age requirement
Equestria Girls: Crossing Worlds Discord server profile picture
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
2.4k
22
0
Server overview
134Total members
1years old
16Age requirement
DECEIT [RP] Discord server profile picture
DECEIT [RP]
communityroleplayrp
Description

˗ˏˋ ✞ ˎˊ˗ 𝐃𝐄𝐂𝐄𝐈𝐓 ˗ˏˋ ✞ ˎˊ˗ “I will not tell you the visceral details as you already know them, you all do. It's happening to every-body.”
═══════════════
On the eve of the outbreak, Southwood, Alabama's population sat at 8,000. Now? hundreds, a bustling coastal city transformed into nothing more than a shell of it's former glory. It wasn't always this way, yet an inconceivable turn of events left thousands wondering if hope was well and truly lost. You weren't lucky enough to be picked up by the military convoys that left town at the behest of the United States Government, no, you were left behind, discarded, and no matter how unhappy you were about that fact, nothing could change how you were now among Fairhope's last remaining inhabitants. There was no telling just what could happen, the cataclysm of the world as we know it was sure to bring about some major changes. Were you going to embrace it, or desperately cling onto whatever hope humanity had left..?
═══════════════
“No-one you know is a good person.”
═══════════════
What Deceit Offers... {✞}

HORROR + APOCALYPTIC THEMES — Built by a team of previous apocalypse-RPers, Deceit offers a range of apocalyptic themes within it's plotlines, all based in the fictional coastal town of Southwood, Alabama . We don't merely focus on the dark, gritty aspects of the apocalypse, but also the wider picture. We aim to make our world as immersive as possible so that everyone can get the most enjoyment out of roleplaying here.

{✞} CREATIVE SPACE FOR ALL SKILL-LEVELS — With the rise in AI over recent years, we've noticed a severe lack in creative spaces. Deceit offers a creative outlet for writers of all skill-levels, whether you're literate writer who wants to improve their work, or a multi-paragraph writer who wants to tell an immersive story, there's a place for you here. AI is banned entirely.

{✞} INTERACTIVE LORE — We've implemented not only a D20 system, but also certain guidelines for events that mean your choices matter. There are real stakes behind every choice your character makes, meaning every single session carries a unique sort of tension. {✞} MEMBER FEEDBACK — Ultimately, we are not immune to taking criticism. If there are certain aspects of the server that you think could be improved upon, then tell us so we can ensure a positive experience for everyone.
═══════════════

Today's activity
98
10
0
Server overview
40Total members
2years old
13Age requirement
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥 Discord server profile picture
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥
dungeons and dragonsd&dttrpghobbiesdndtabletoproleplay
Description

The City of Brass is a place for people to share and discuss their hobbies, favorite media, and worldbuilding projects; whether it be for a tabletop game like Dungeons and Dragons, or just for the fun of it! We also like to make and give/receive feedback on Hombrew content for D&D!

Today's activity
87
9
0
Server overview
64Total members
4years old
18Age requirement
Avalon Community | Dedicated Servers & Real Players Discord server profile picture
Avalon Community | Dedicated Servers & Real Players
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
86
13
0
Server overview
1.0kTotal members
8years old
13Age requirement
Test Subjects Official Roleplay Discord server profile picture
Test Subjects Official Roleplay
sciencehumansroleplayrealtestinglab
Description

✨ Welcome to Test Subjects ✨

⚙️ The Facility:
A secret lab where science pushes boundaries.

🔬 Roles:

Test Subject: Endure experiments, gain powers or mutations.

Scientist: Conduct experiments, manipulate subjects, chase breakthroughs.


🧬 What Awaits:

Powers, mutations, or failures.

Dangerous tests.

Power struggles, escape attempts, and secret agendas.


🧪 The Question:
Will you thrive, rebel, or control the chaos?

Step into the lab... the experiment begins now.

✨ Welcome to Test Subjects ✨

⚙️ The Facility:
A secret lab where science pushes boundaries.

🔬 Roles:

Test Subject: Endure experiments, gain powers or mutations.

Scientist: Conduct experiments, manipulate subjects, chase breakthroughs.


🧬 What Awaits:

Powers, mutations, or failures.

Dangerous tests.

Power struggles, escape attempts, and secret agendas.


🧪 The Question:
Will you thrive, rebel, or control the chaos?

Step into the lab... the experiment begins now.

Today's activity
25
3
0
Server overview
24Total members
1years old
13Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
5.4k
46
6
Server overview
719Total members
6years old
14Age requirement
Description

⋆·˚ ༘ * few people in this world are capable of surviving, those of us who are weak will die, and those of us who are strong will fight against the negative emotions of mankind - curses. a twisted reality full of demented creatures, and yet you stand tall amongst us.

live or die, take your pick.

- - - for a tomorrow without tears is a JJK server set in season one of the anime, though we allow characters that show up after that! events are likely to happen, and mods are open for any and all ideas that you may have. we hope to see you there!

? ? ? what do we offer ?

; ; many role-play channels , and are always taking suggestions for more .

; ; plenty of open CC’s waiting to be claimed , and in need of a lot !!!

; ; easy character submissions .

; ; oc and cc’s allowed! up to 4 canon characters and unlimited original characters.

; ; non - toxic server and interactive staff

Today's activity
6
3
0
Server overview
27Total members
1years old
16Age requirement
Description

This is a server based off the hunger games! It takes place in the 86th game with new victors waiting to be made and spots left!! Come join

Today's activity
48
3
0
Server overview
73Total members
2years old
13Age requirement
The Lords Of Geek 🔞 Discord server profile picture
The Lords Of Geek 🔞
socialcommunitychillgaminghangoutanimefriendsfunartvcmusicactivememesmangamoviesevents18+marvelmultifandomstreamingfriendshipxboxbookstechnologyfandomdcsci-fiplaystationstar warsadult onlyentertainmentcomicsroleplayingnintendopc gamingcontent creatorpodcastsspider-manconsole gamingdiscussionsadultgamerstelevisiontv showspop culturenerd culturetabletop gaminggeek cultureenglish
user profile pic
renegadeoperative07-06-2026 22:03

⚡ Nerds rule the world. Gaming • Anime • Comics • Movies • Podcasts • Events • Community Chaos | Join Lords of Geek today.

Description

The Infinite Ammo Syndicate - Lords Of Geek is a community Discord which covers everything within variety nerd culture. We discuss gaming, anime, comics, movies, and everything in between. You know what they say? Nerds rule the world.

☞︎𝐖𝐡𝐚𝐭 𝐰𝐞 𝐨𝐟𝐟𝐞𝐫☜︎
--------------------------------------------------------------------
🧧▸ An 18+ geek community for fans of gaming, anime, comics, and pop culture.
🧧▸ A gaming hub for co-op, multiplayer, party games, and finding other players.
🧧▸ Active chats, voice chats, and daily conversations across geek culture.
🧧▸ Anime, movie, television, and watch party discussions.
🧧▸ A multifandom hub covering gaming, anime, comics, sci-fi, fantasy, and pop culture.
🧧▸ A place to share fan art, cosplay, writing, and other fandom creations.
🧧▸ Events, podcasts, community spotlights, and other geek-centric activities.
🧧▸ Memes, banter, fun, and the occasional controlled dose of community chaos.

Today's activity
3.9k
45
14
Server overview
376Total members
10years old
18Age requirement
Description

***TOKYO GHOUL - TRIBUTES***

*This server is 16+!*
It is modern day Tokyo. Years have passed since the Dragon War. Faux allyships between Ghoul and Mankind have crumbled like castles under poor leadership and glorified silver linings. From the ashes rose tired, angry, and vengeful ghouls that were given fragile promises and hope at living a normal life.

The United Front and newly-instated CCG, lead by Matsuri Washuu, are now at war. The CCG believes that it is their rightful title as Japan's proper justice division and that all ghouls must be executed as a means to prevent a third-wave’s occurrence as well as another Dragon Incident. The wards have been distorted in chaos underneath the surface, as constant warring over Tokyo's wards appears to be never-ending.

The strange world just got stranger. The dead are mysteriously rising, old organizations are returning with new faces and new leadership, and the ghoul and human worlds as we know it are headed for significant changes.

Here there is a very lax ranking system, meaning that, until the free-spots are filled for higher ranking ghouls / investigators you may have to have your character be higher ranked. For those that miss out, do not fret. We are solely-activity based, meaning the longer / more active you are the higher the rank you can become via the Arcane bot level system **in roleplay channels only**. Both canons and original characters are welcome. Create your own paths - your lore is incorporated into the server's lore. Have fun and enjoy your stay!

*What we offer*

- Unlimited OCs
- A complete, unique server with all 24 wards and location channels within them
- Semi-lit - Adv. Lit RP
- A small but growing community of friendly, creative people
- Canon Character roles
- Gartic, music bots and streaming voice chats

Today's activity
32
4
0
Server overview
62Total members
2years old
16Age requirement
Taisho High: The First Aces! Discord server profile picture
Taisho High: The First Aces!
fantasyhighschoolmagicocroleplaysci-fi
Description

WELCOME TO THE GRAND REOPENING OF TAISHO HIGH!

Whether you're a visitor looking in, or returning member, we welcome you with open arms! We're an exciting high school based RP server, which takes place further inti the future!

✨Rise through the ranks and discover your true power! ✨

At taisho high, you can expect:

* An easy to understand class system

* Wide range of freedom for OC'S

* Several opportunities for deep character development

* Engaging events, with valuable server rewards

* Helpful staff

* Progression of power

And much more!

Will you become a true Ace?

Today's activity
21
4
0
Server overview
62Total members
2years old
13Age requirement
Teyvat Roleplay Discord server profile picture
Teyvat Roleplay
genshinroleplayteyvatlgbtq
Description

7th grade to senior high school only, mostly genshin impact roleplaying but also other stuff just socializing

Today's activity
29
3
0
Server overview
6Total members
1months old
13Age requirement
/saucee | ask2dm • egirls • dating • social • active Discord server profile picture
/saucee | ask2dm • egirls • dating • social • active
communitysocialchillroleplaygamesanimefriendsactivemoviesdatingegirlactive-voicechatedatingfreakyvc
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
27
14
1
Server overview
1.8kTotal members
1years old
18Age requirement
Description

✉️ SEND OR RECEIVE DM REQUESTS! ✉️ Step into a welcoming community where every member can shape their own identity. 🎭 With 150+ self-assignable roles, you can showcase your hobbies, interests, personality, and more.

Discord Dating Server, Dating Discord Server, 18+ Discord Server, Discord Dating Community, Online Dating Discord, Discord Love Server, Discord Singles Server, Dating Server Discord, Discord Chat Dating, Discord Relationship Server, join dating discord server, best discord dating servers, active dating discord server 18+, safe dating discord community, meet singles on discord, discord server for dating and relationships, discord matchmaking server, discord flirt server 18+, find partners discord server, real-time chat dating discord, best 18+ dating discord servers to join, active discord dating servers for adults, how to find dating servers on discord, discord servers for singles and relationships, safe discord dating communities 18 and up, discord server to meet new people romantically, discord dating chat rooms 18+ active users, join discord server to meet singles online, best places to meet people on discord for dating, dating and friendship discord server 18 plus, discord social server, discord friendship and dating, online community for singles, meet people online discord, casual dating discord server, serious dating discord community, voice chat dating discord, text chat dating server, gaming and dating discord server, international dating discord server, adult discord dating chat, discord meetup server, social discord for adults, flirt and chat discord server, relationship building discord server, singles chat 18+ discord, make friends and date discord server

Today's activity
15.0k
1.1k
34
Server overview
6.0kTotal members
4years old
18Age requirement
Mega Man X: Maverick Discord server profile picture
Mega Man X: Maverick
mega manmegamanmega man xmegaman xroleplay
Description

Sirens in the Distance is a 20+ roleplay server, set in the Mega Man X timeline. We are a living and evolving alternate universe, giving players opportunities to introduce their own stories and expand on the MMX lore. We offer a mature, sandbox-style setting, with multiple open-ended plots, allowing players to meaningfully change the course of the Maverick Wars. We are new player-friendly! Prior knowledge of the MMX setting is not required. Canons, OCs and fangame characters are welcome! So come check us out!

Today's activity
9
3
0
Server overview
44Total members
2years old
18Age requirement
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★ Discord server profile picture
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★
roleplaysocialcommunitychillanimehangoutcreativemangaliterateocbleachbleach rpbleach roleplayanime rpanime roleplaymanga rp
user profile pic
coolin.real15-11-2024 18:14

hi guys!

Description

[**``黒— ★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★``**] ***Join our server for an interesting run, an adventure throughout multiple different worlds and realms, a deeper perspective on several different races and untold stories in this entirely new world. You may fight strong opponents, take on new heights, push yourself beyond your limits and even face off against those above! With or without a purpose, be a an active participant in the lore of our server that revolves entirely on you all. Destroy the strongest hollows or even reapers, quincies, fullbringers, humans (hell anything you name it) this era has ever known or just simply do your own thing; Awaken a bankai, shoot arrows, become an espada or develop a mask! The opportunities are practically endless in this Mugetsu world! With several systems to guide your very actions and several people willing to rp with you where could things go wrong? immerse yourself in our very own Bleach universe, and interact with fellow fans. With engaging roleplay, thrilling storylines, and a welcoming community, this server is the ultimate destination for fans of all ages. Don't miss out on the chance to explore the vast world of Bleach and create unforgettable memories with like-minded enthusiasts. Join now and let’s start up this journey today, Karakura town is awaiting you!*** **Our own unique take on Bleach, you took the time to read this far so we KNOW you’re interested!** **``We offer: A forum based oc submission system where we can easily interact with you and point out certain details Several different templates for multiple different things such as weaponry, zanpakuto, and the different races showcased in the anime/manga! An active staff team The chance to influence the story or have your own arcs Be part of the main cast! Everyone is really, I mean it! A multitude of different systems for important techniques and skills such as the transformations (such as bankai, shikai, training, resurrecion and mastery) A lot of channels that give background information on what you can do with the bleach power systems so even if you haven’t actually seen the series or read the manga you could read up for a basic understanding! The chance to utilise cool transformations, zanpakuto's, kido spells, or even create your own Influence a moving plot a money system a moving story and a chance to give your own two cents``** ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Links: https://discord.gg/uKK8Q3nggG [let's go, your journey starts now!](https://tenor.com/bQ7nQ.gif) Pings: ||@everyone @here||

Today's activity
19
4
0
Server overview
466Total members
1years old
13Age requirement
Якудза Discord server profile picture
Якудза
socialchillgaminggamesworld of warcraftjapancommunityroleplayanimefriendsfunfriendlyartchatactivemusicmemesmoviesrpmangaeventsprogrammingcreativenon-toxicvoicechattingreading
Description

Невыносимые ограничения, дотошные лицемерные правила... Устали от всего этого? Ищете взаимопонимания? В нашем самом вольном объединении рады всем, кто на стороне Справедливости.
Вступайте в семью!

Мы - атмосферное сообщество, объединяющее людей разных фриланс-профессий, талантов и интересов. Наш оригинальный подход направлен на поддержание духа свободы и взаимопомощи.

На нашем уютном сервере вы найдёте:
✓ Приветливое сообщество фрилансеров с анкетами для работы
✓ Дизайнерскую стилизацию под японскую тематику с аутентичными картинками и философскими фразами с глубоким смыслом
✓ Уникальную демократическую систему политической жизни сервера с выбором клана
✓ Разнообразные чаты для вольного общения, игр и интересов
✓ Своя вольная гильдия без требований в World of Warcraft
✓ Полную свободу выбора и действий

В нашем самом свободном сообществе каждый найдёт для себя своё место!

Помните главное:
Вместе мы подобны течению десяти тысяч рек, впадающих в океан. Объединение - вот ключ к успеху.

Today's activity
14
4
2
Server overview
125Total members
4months old
16Age requirement
Yo Kai Watch Forever! [RP] Discord server profile picture
Yo Kai Watch Forever! [RP]
roleplayyo-kai watch
Description

[QUICK DISCLAIMER: This is a ROLEPLAY server. If you are here to trade, do not join.] 2 worlds exist, the human world, and the Yo Kai World. They used to be separate, but some time, long ago in the past, their borders got hazy and Yo-Kai started to pour in, and cause all sorts of troubles for humans! Completely invisible to the human eye, they inspirit people and cause problems ranging from the mild annoyance to major danger. Luckily, a device exists to allow humans to see and even befriend the Yo-Kai! Can a peace be reached between the 2 worlds, or is an unseen catastrophe right on the horizon?

Today's activity
14
4
0
Server overview
228Total members
5years old
13Age requirement
Animation Destination Role-play Discord server profile picture
Animation Destination Role-play
roleplaydisneydreamworksilluminationnickelodeon
Description

Hi! I'm looking for mature people or people 18 years of age and older that love animation to join a Discord roleplay. Roleplay in any style you want. You can choose animated characters from Disney, DreamWorks, Illumination, Nickelodeon, and more. Hope to see you there!

Today's activity
11
3
0
Server overview
44Total members
1years old
18Age requirement
Fluid Client Discord server profile picture
Fluid Client
communitysocialactivechillroleplaygaminghangoutgamescreativefriendsfunfriendlyartchatmusicvcsfwrobloxminecraft
Description

Ready to take your Minecraft adventures to the next level? Fluid Client, the unrivaled Minecraft client for 1.8.9, is your ticket to endless possibilities! 🌍 Unleash your imagination, conquer challenges, and build your way to victory! Download now at https://fluidclient.ovh/download.

Today's activity
71
16
0
Server overview
9.7kTotal members
3years old
13Age requirement
Description

ꕤ˖⸝⸝₊˚ Heiwa: 𝐆𝐨𝐥𝐝𝐞𝐧 𝐅𝐚𝐭𝐞 — a Medieval Fantasy Roleplay Server Long ago, the Epoch Shift shattered history; revealing a hidden orange-glowing moon, Nimiel, and changing the world as we know it. Civilizations now rise from the ruins, rediscovering old gods, lost kingdoms, and mysterious crystals embedded deep within the land. Ecosystems evolving far faster than we can keep up with, people redefining themselves and their lives. In this world, magic is a muscle, not an infinite force. Each spell strains the body. Power comes from training, endurance, and discipline. Your story begins here - when anything and everything you do can change the course of the story, how will you choose to live? 𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃 Heiwa is currently in a TRIAL PHASE. From now until NEW YEARS, the server is open for character-making and roleplaying, but no important lore events will occur. If you want to get in to make a mark before we truly kick off, now is the time! Deep, original lore (two moons, a shattered epoch, divine politics, unique magic system) Friendly, active community OC-focused, literate & semi-literate roleplay Medieval fantasy aesthetic Multiple regions, factions, and cultural paths Helpful staff, open channels for new players Event-driven storytelling + player-driven plots Safe, welcoming environment for all Ready to step into the new era? Join the world shaped by Mōna and awakened by Nimiel. Your story awaits.

Today's activity
571
21
15
Server overview
108Total members
6months old
13Age requirement
|| JJK || The Jujutsu Experience Discord server profile picture
|| JJK || The Jujutsu Experience
jjkjjk roleplayjjk rpjujutsu kaisenjujutsu kaisen roleplayjujutsu kaisen rproleplay
user profile pic
gumeybear2122-09-2024 13:04

a

Description

The Jujutsu Experience! It's a roleplaying/hangout JJK server!! Your oc's make the future! It's simple and an up n' coming server. - Cannon Techniques to be claimed by YOUR ocs ;o - Friendly staff (I think I'm friendly anyways) - Easy to understand templates - Sukuna's vessel up for grabs >:)) So why don't you come on down and join! Even if you just want to hangout and chat, that's what we're here for, but if you want to rp, come make an oc that'll shape the lore of the server!

Today's activity
65
4
1
Server overview
254Total members
1years old
13Age requirement
WHERE THE WIND LEADS.||multifandom au Discord server profile picture
WHERE THE WIND LEADS.||multifandom au
multifandomroleplaymultifandom roleplaycrossover
Joininactive
Description

Where The Wind Leads is a multifandom/crossover slice of life AU! We allow nearly anyone to be added.

What we offer:
-A relaxed roleplay environment with a decent OOC section.
-An optional internet category.
-Simple, moldable lore moved by character interaction!
-Newly revamped, with a dedicated mod team and fun community!
15+ community with a strict NSFW policy.

We hope to see you here!
Bot count: 14
https://discord.gg/PCSxVCeCED
if either link does not work dm jonmartins

BEGGING OF YOU PLS PLS JOIN WE ARE AWESOME AND COOL <— biased owner

Today's activity
35
2
0
Server overview
69Total members
3years old
15Age requirement
WWE TNA: New Impact Discord server profile picture
WWE TNA: New Impact
roleplaytnawrestlingwwe
user profile pic
tkadecell10-09-2023 23:07

YEAH

Description

Welcome to a wrestling universe where WWE and TNA are together for the first time ever. Here we bring in a new impact filled roster full of the best wrestlers today and so much more. Wrestling Nostalgia Series Weekly Episodes Awesome Community Friends That is just a example of what we offer in this server, so if you're ready to make a impact then let's see whatcha got.

Today's activity
33
2
0
Server overview
16Total members
2years old
18Age requirement
Description

𝐁𝐥𝐮𝐞 𝐋𝐨𝐜𝐤: 𝐒𝐭𝐫𝐢𝐤𝐞𝐫𝐬 𝐏𝐚𝐭𝐡

⥼─────────────────────────[広告]──────────────────────────⥽

The Japanese national team finished 16th in the FIFA World Cup. As a result, the Japan Football Association hires the football enigma Ego Jinpachi. His master plan to lead Japan to stardom is Blue Lock, a training regimen designed to create the world's greatest egotist striker. Forwards, receive and invitation from Blue Lock.
⥼─────────────────────────[広告]──────────────────────────⥽
BLUE LOCK
Blue lock is a popular manga series written by Muneyeki Kaneshiro and illustrated by
Yusuke Nomura.

⥼─────────────────────────[広告]──────────────────────────⥽
"𝐁𝐥𝐮𝐞 𝐋𝐨𝐜𝐤: 𝐒𝐭𝐫𝐢𝐤𝐞𝐫𝐬 𝐏𝐚𝐭𝐡" is a interactive fan-made Blue Lock roleplay server
with canon events and OC made by you. We have handmade systems and many different things that sets us apart from other blue lock servers, as we strive to grow and gain more members as a whole.

⥼─────────────────────────[広告]──────────────────────────⥽

We offer ↴

Admins & Members
Booster Perks
Choose your own teammates
Oc Driven Story
Organized Systems
Traits
|| @everyone @here ||
Invite Link ↴

https://discord.gg/RSbrWAzxHR

⥼───────────────────────────────────────────────────⥽

Today's activity
32
2
0
Server overview
36Total members
1years old
13Age requirement
⿻   ;   palace   of   satoru Discord server profile picture
⿻ ; palace of satoru
jjkjujutsu kaisen roleplayroleplayjujutsu kaisenjjk rp
Joininactive
Description

palace of satoru is a semi-lit to novella rp server with only canon characters allowed. we have a stat system and gamemasters. we are looking for staff and gamemasters because we are very new.

Today's activity
32
2
0
Server overview
21Total members
1years old
13Age requirement
Inglorious Sovereignty Discord server profile picture
Inglorious Sovereignty
animegamescommunitysocialroleplay
user profile pic
thenuclearwarhead08-04-2024 03:47

Alot of cool emojis from jjk, csm, devil may cry, final fantasy and guilty gear

Description

A wonderous server full of people with multiple interests like gaming, anime, music, movies, sharing your hobbies and etc. this server has no rules because what you say shouldn't effect anyone. it should be no different from any conversations you have in real life. I pride myself in the fact this is indeed a multifandom server, i personally like media like pokemon and other games, aswell as movies like The crow or The punisher.

Today's activity
32
2
0
Server overview
52Total members
2years old
13Age requirement
Nations of the World 2.0 Discord server profile picture
Nations of the World 2.0
nrpnation-rpgeopoliticsroleplaycountry-rp
Joininactive
Description

Welcome to Nations of the World!
Come join and rule your country of choice, or just design an entire new nation! We have lots of things to do!

Nations of the World is a NRP geopolitics server that is very new and building up a community. Since we're very new we could really use some help building our community, so what are you waiting for? Come join!

The things we offer:
- Job positions
- Realistic Roleplay
- Helpful Staff
- A small welcoming community
And much more!
Come join and find out if this is something for you!

What can you do to help our server:
- Create a nation/rebellion/company
- Submit an application for a staff role
- Share the server with your friends
- Submit suggestions in the specified channel

We are looking forward to meet you!
We hope we'll see you in the server.

Today's activity
25
2
0
Server overview
16Total members
2years old
16Age requirement
Cat House Discord server profile picture
Cat House
catsgamesfurryfemboyroleplayidk
Joininactive
Description

This is new server idk what it about u may join and help find out (waw what rhymes)

Ignore tags i wrote what i liked this can change soon!

Today's activity
25
2
0
Server overview
21Total members
2years old
16Age requirement
Las Vegas RolePlay Discord server profile picture
Las Vegas RolePlay
gta vxboxroleplaygta rp
Joininactive
Description

A new GTA V rp server for xbox rises up, come and join, join the community.

Today's activity
24
2
0
Server overview
27Total members
1years old
15Age requirement

207 servers found