Roleplay Discord servers

211 servers found

Description

A Hunger Games roleplay!

Today's activity
1.4k💬
46🟢
45👥
2📞
Server overview
122👥Total members
3📅years old
16+Age requirement
Description

[QUICK DISCLAIMER: This is a ROLEPLAY server. If you are here to trade, do not join.] 2 worlds exist, the human world, and the Yo Kai World. They used to be separate, but some time, long ago in the past, their borders got hazy and Yo-Kai started to pour in, and cause all sorts of troubles for humans! Completely invisible to the human eye, they inspirit people and cause problems ranging from the mild annoyance to major danger. Luckily, a device exists to allow humans to see and even befriend the Yo-Kai! Can a peace be reached between the 2 worlds, or is an unseen catastrophe right on the horizon?

Today's activity
53💬
44🟢
7👥
0📞
Server overview
237👥Total members
4📅years old
13+Age requirement
server profile pic
Animation Destination Roleplay
roleplayDisneyDreamWorksilluminationNickelodeon
Description

Hi! I'm looking for mature people or people 18 years of age and older that love animation to join a Discord roleplay. Roleplay in any style you want. You can choose animated characters from Disney, DreamWorks, Illumination, Nickelodeon, and more. Hope to see you there!

Today's activity
37💬
7🟢
10👥
0📞
Server overview
40👥Total members
8📅months old
18+Age requirement
server profile pic
|| JJK || The Jujutsu Experience
jjkjjk roleplayjjk rpjujutsu kaisenjujutsu kaisen roleplayjujutsu kaisen rproleplay
user profile pic
gumeybear2122-09-2024 13:04

a

Description

The Jujutsu Experience! It's a roleplaying/hangout JJK server!! Your oc's make the future! It's simple and an up n' coming server. - Cannon Techniques to be claimed by YOUR ocs ;o - Friendly staff (I think I'm friendly anyways) - Easy to understand templates - Sukuna's vessel up for grabs >:)) So why don't you come on down and join! Even if you just want to hangout and chat, that's what we're here for, but if you want to rp, come make an oc that'll shape the lore of the server!

Today's activity
3.8k💬
102🟢
58👥
10📞
Server overview
236👥Total members
1📅years old
13+Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
3.8k💬
122🟢
30👥
0📞
Server overview
633👥Total members
5📅years old
14+Age requirement
server profile pic
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
838💬
56🟢
34👥
0📞
Server overview
332👥Total members
3📅years old
16+Age requirement
server profile pic
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
670💬
50🟢
16👥
0📞
Server overview
223👥Total members
2📅years old
13+Age requirement
server profile pic
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
51💬
24🟢
9👥
0📞
Server overview
98👥Total members
1📅years old
16+Age requirement
server profile pic
city in the sky · fluffy tag
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
12.0k💬
250🟢
107👥
1📞
Server overview
2.5k👥Total members
10📅months old
13+Age requirement
server profile pic
The Democratic Server of Kaeska
political roleplaypoliticschattingroleplay
Description

The Democratic Server of Kaeska is a place where YOU can take charge. Create or join the political parties of your dreams. Run for President. Create laws. Vote on issues. Win the hearts of your fellow servermates. Created and moderated by an experienced team of people, we feature a custom discord bot, and a thriving community. Will Kaeska be the perfect utopia? Or will you run it into the ground? The choice is YOURS. Welcome to the Democratic Server of Kaeska.

Today's activity
48💬
25🟢
6👥
0📞
Server overview
101👥Total members
10📅months old
13+Age requirement
server profile pic
A Helluva Fire and Heavens Glow
roleplaylgbtq+literaterpcreativesemi-literatehazbin hotelnovellahelluva bosssemi-lithellhelluvahazbin hotel rphazbinhelluva boss rp
Description

✧ 𝐀 𝐇𝐞𝐥𝐥𝐮𝐯𝐚 𝐅𝐢𝐫𝐞 𝐚𝐧𝐝 𝐇𝐞𝐚𝐯𝐞𝐧’𝐬 𝐆𝐥𝐨𝐰 ✧ Hey there, wayward sinner. Are you a fan of Hazbin Hotel or Helluva Boss? Do you enjoy diving into rich, character-driven roleplay? Then welcome aboard. This is a roleplay server inspired by Vivziepop’s creations—Hazbin Hotel and Helluva Boss—with a focus on detailed storytelling, strong character arcs, and a community that thrives on creativity. ✧. ┊  𝘛𝘩𝘪𝘴 𝘪𝘴 𝘢 𝘭𝘰𝘳𝘦-𝘩𝘦𝘢𝘷𝘺, 𝘭𝘰𝘳𝘦-𝘧𝘰𝘤𝘶𝘴𝘦𝘥 𝘴𝘦𝘳𝘷𝘦𝘳 𝘣𝘶𝘪𝘭𝘵 𝘧𝘰𝘳 𝘴𝘵𝘰𝘳𝘺𝘵𝘦𝘭𝘭𝘦𝘳𝘴. ┊.✧ ✧ 𝗪𝗛𝗔𝗧 𝗬𝗢𝗨 𝗖𝗔𝗡 𝗘𝗫𝗣𝗘𝗖𝗧 ✧ ★ — A variety of channels to explore, both IC and OOC ★ — Fun, multipurpose bots to enhance your RP experience ★ — Required, in-depth character templates to help shape your creations ★ — An active, reliable staff team that’s here for you ★ — Semi-lit to novella styled writers welcome ★ — Simple, clean server layout ★ — 18+ server | ID verification is mandatory ✧ 𝗢𝗩𝗘𝗥𝗩𝗜𝗘𝗪 ✧ This is a roleplay server for Hazbin Hotel and Helluva Boss, built by fans for fans. 𝙒𝙚’𝙧𝙚 𝙖 𝙛𝙖𝙣𝙤𝙣 𝙡𝙤𝙧𝙚-𝙘𝙚𝙣𝙩𝙧𝙞𝙘 𝙘𝙤𝙢𝙢𝙪𝙣𝙞𝙩𝙮, and we take pride in weaving complex stories and character arcs together. Everyone is welcome here—no matter who you are. Our mod team is committed to keeping things safe, inclusive, and drama-free. You can claim up to 2 canon characters and submit as many OCs as your hellish (or heavenly) heart desires. Many major roles are still open, be sure to come in and grab them quick~! We’d love to have you join our circle—come be part of the story. ♡

Today's activity
1.2k💬
17🟢
26👥
5📞
Server overview
55👥Total members
2📅years old
18+Age requirement
server profile pic
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
1.7k💬
625🟢
97👥
31📞
Server overview
5.0k👥Total members
4📅years old
13+Age requirement
server profile pic
Avalon Community Servers
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
188💬
115🟢
10👥
0📞
Server overview
983👥Total members
8📅years old
13+Age requirement
server profile pic
Sauce
socialcommunitychillroleplaygamesanimefriendsactivemoviesegirlfreakyactive-voicechatdatingedating
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
12.6k💬
96🟢
47👥
1📞
Server overview
982👥Total members
9📅months old
13+Age requirement
server profile pic
𝗗𝟰
communitysocialchillroleplaygaminggamesanimehangoutfriendsfunfriendlyartchatmusicsfwvcrobloxminecraftactivemangamoviesmemeseventsfortniterpvalorantcreativeprogrammingweedgtasmoking420equalityd4amongusstoner
Description

A server designed to fit the interests of every member that joins, while being a safe community.

● 𝐀 𝐂𝐎𝐌𝐌𝐔𝐍𝐈𝐓𝐘 𝐌𝐀𝐃𝐄 𝐅𝐎𝐑
┃ WEEBS
┃ GAMERS
┃ STONERS
┃ SKATERS
┃ ARTISTS
┃ HIPPIES
┃ EQUALITY
┃ ATHLETES
┃ MUSICIANS
┃ PROGRAMMERS
┃ MOVIE NIGHTS
┃ CONTENT CREATORS
┃ FREEDOM OF ┃EXPRESSION
● 𝗛𝗘𝗥𝗘 𝗔𝗧 𝗗𝟰 𝗪𝗘 𝗖𝗔𝗧𝗖𝗛 𝗣𝗘𝗗𝗢𝗦

Today's activity
1.1k💬
100🟢
33👥
10📞
Server overview
386👥Total members
5📅months old
13+Age requirement
server profile pic
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
577💬
2.1k🟢
44👥
13📞
Server overview
12.3k👥Total members
8📅years old
13+Age requirement
server profile pic
Court of Contortions
roleplayliteraterplabexperimentcircus
Description

The show has only just begun so hurry in and join the fun at the Court of Contortions! During the 90s in Maine there was a circus built off the back of a failed pharmaceutical company that only the exorbitantly wealthy could afford to go too, there were plenty of rumours that all the missing people in the city ended up performing there and...well they're all true! The Court of Contortions kidnapped people for performers and used dangerous drugs to alter them and give them abilities they can use to wow a crowd with, they also have plenty of harmful side effects but we don't talk about that. So if you're looking for a job, the show of your life or if you were taken here against your will we promise the Court of Contortions has something for you!

Literate.
We expect our members to be semi lit to lit, it's ok if you slip up sometimes but if you're literacy rate is one line this servers not for you

Creative freedom.
Its up to you what abilities your performer has and there's no set list of choices, that being said we have a few rules of what won't be allowed to keep things fair.

Helpful staff team.
We have quite a lot of staff here so if you need help writing your oc, have concerns about a server member or just wanna suggest improvements for the server there should be someone to listen.

Our age range is 15+ please don't join if you're below

Today's activity
8💬
20🟢
3👥
0📞
Server overview
52👥Total members
7📅months old
15+Age requirement
server profile pic
The Lorin Sector: A 40K RP
000character rproleplaywarhammerwarhammer 40
user profile pic
warmind_d409-01-2024 16:20

.

user profile pic
caliph333309-01-2024 08:18

AAAAAAAAAAAAAAA

user profile pic
caliph333310-12-2023 19:34

Join it NOW

Description

The Lorin Sector is an Imperial Sector in the Eastern Fringes caught between the T’au Empire, Realm of Ultramar, the Exodite Worlds, the Jericho Reach, and the Scourge Stars. This territory represents a rugged frontier of Imperial Space, having been far gone ever since the Cracks within Imperial Authority during the Nova Terra Interregnum. Fairly isolated from the million-strong armies and mighty Battlefleets of the Imperial Heartland, it is a Sector that is ultimately blessed by its positioning, yet must always fend for itself against the threats creeping in. May it be Genestealer Cults, Xenos Races, Warp Spawn and their Mortal Followers, Redemptionists, or even Dark Ancient Forces beyond all of them. This Warhammer Roleplay is generally based around relative freedom to play what you desire. Although we somewhat focus on playing various Warlords of different factions, we generally try and offer options for character campaigns and the like. We have a relative large staff that is friendly and will attempt to help others in need. Feel free to hop in!

Today's activity
27💬
78🟢
9👥
0📞
Server overview
288👥Total members
1📅years old
15+Age requirement
server profile pic
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥
dungeons and dragonsd&dttrpghobbiesdndtabletoproleplay
Description

The City of Brass is a place for people to share and discuss their hobbies, favorite media, and worldbuilding projects; whether it be for a tabletop game like Dungeons and Dragons, or just for the fun of it! We also like to make and give/receive feedback on Hombrew content for D&D!

Today's activity
109💬
29🟢
6👥
0📞
Server overview
78👥Total members
4📅years old
18+Age requirement
Description

a good roleplay server with a gossip girl based lore!

Today's activity
96💬
40🟢
9👥
0📞
Server overview
320👥Total members
2📅years old
13+Age requirement
server profile pic
/pupcore ‧˚🐾⋆🦴୭
communitysocialchillroleplayhangoutmusicfurryrpnon-toxic18+
Description

Haiii you've discovered /pupcore! Welcome to a friendly, non-toxic pet-play server for the silly, whimsical, and playful! Whether you're a pup, owner, or just looking for a community, come fetch your spot! Psst — new pups get a treat! 𐂯 >.<

🦴 | Accepting friendly space! ♡

🦴 | SFW mostly, no NSFW focus!

🦴 | Cute emotes & stickers!

🦴 | Intro + looking for channels!

i hope to see you there! ^-^

Today's activity
92💬
39🟢
31👥
2📞
Server overview
65👥Total members
1📅months old
18+Age requirement
server profile pic
the Eternity
horrorroleplaywriting
Description

a new, somewhat horror based rp server set in a luxury hotel. Ocs and canon characters are allowed. We're just starting off, so join now!

Today's activity
89💬
10🟢
4👥
0📞
Server overview
18👥Total members
2📅years old
16+Age requirement
server profile pic
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
79💬
59🟢
14👥
0📞
Server overview
199👥Total members
2📅years old
13+Age requirement
server profile pic
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
242💬
34🟢
10👥
0📞
Server overview
136👥Total members
4📅years old
15+Age requirement
Description

A pretty chill Kirby Roleplay server. Just follow the rules and you’ll have fun. We’re currently a small server and we hope to see you join

Today's activity
8.4k💬
31🟢
14👥
0📞
Server overview
63👥Total members
6📅months old
13+Age requirement
server profile pic
RP n’ Chill
role-playroleplay
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
2.3k💬
191🟢
44👥
0📞
Server overview
1.1k👥Total members
5📅years old
15+Age requirement
server profile pic
Fluid Client
communitysocialactivechillroleplaygaminghangoutgamescreativefriendsfunfriendlyartchatmusicvcsfwrobloxminecraft
Description

Ready to take your Minecraft adventures to the next level? Fluid Client, the unrivaled Minecraft client for 1.8.9, is your ticket to endless possibilities! 🌍 Unleash your imagination, conquer challenges, and build your way to victory! Download now at https://fluidclient.ovh/download.

Today's activity
62💬
524🟢
47👥
0📞
Server overview
9.4k👥Total members
2📅years old
13+Age requirement
server profile pic
Grim Circus
roleplayfunrpocblyaoicircushorrorromance
Description

A yaoi rolepay server loosely inspired by the Dark Woods Circus song
------
A circus rolls into town, the sound of a train on long abandoned tracks, tents set up at the edge of town. The forms of the performers is strange, a deformed beauty with the voice of an angel, the ringmaster with the glowing eyes and pointed teeth hidden behind a charming smile.
As men start to go missing, the circus vanishes just as suddenly as it was set up, the only evidence it was ever there is popcorn and hay scattered and trodden into the grass
At the next town, new faces can be found among the members of the circus and there is fresh meat on the plate of the freakshow's cannibal. At the end of the show odd features can not be removed.
The charming ringmaster has tricks up his sleeves. A witch twisted by solitude and torture, he collects boys and twists them like he was, changing their appearance to his fancy with surgery and magic, taking apart those who do not meet his standards for parts, disposing of what he can't use in the bellies of beasts. His collection is cursed and bound so they can never abandon the circus.
Once you are lured into the circus you can never leave.
Are you ready to join the circus?
------
Please only join if you are 18 or older, We'd like to fully be able to explore the horror themes that could apply to the setting. It is however sfw in the main areas.

Today's activity
44💬
8🟢
8👥
0📞
Server overview
17👥Total members
1📅months old
18+Age requirement
server profile pic
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
1.7k💬
40🟢
25👥
9📞
Server overview
122👥Total members
2📅years old
14+Age requirement
server profile pic
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
643💬
50🟢
26👥
13📞
Server overview
1.0k👥Total members
3📅years old
13+Age requirement
server profile pic
Pine Creek Summer Camp 🏕
roleplayrpslice of lifesolcommunity
Description

We are an 18+ SFW roleplay server that mainly focuses on slice of life but we encourage our members to be as creative as they wish. Whether you want some adventure, angst, mystery or romance, we can do it all here.

We encourage creativity and enjoy a smattering of chaos from time to time - whether it be kids getting revenge against a mean staff member, escalating prank wars or accidentally burning down the boathouse with a misplaced firework.

The Pine Creek Summer Camp is an inclusive camp for children and teenagers from all walks of life - with special catering for those who are disabled, neurodivergent or in any way impoverished or troubled. With fun indoor and outdoor activities, all are welcome.

We have dozens of indoor and outdoor locations for 1x1 and small group roleplays as well as chatroom style channels you can use to talk as your characters to other characters. We use Tupperbox for added immersion and are happy to help beginners set up their characters and learn how to use it.

What we offer:
▫️ A welcoming, friendly community
▫️ Inclusive to everybody, regardless of race, religion, gender or sexuality
▫️ Dedicated staff who are passionate about roleplaying
▫️ OOC chat channels
▫️ Media, meme, and art channels

Today's activity
1.5k💬
23🟢
20👥
0📞
Server overview
47👥Total members
3📅months old
18+Age requirement
server profile pic
Mega Man X: Sirens in the Distance
mega manmegamanmega man xmegaman xroleplay
Description

Sirens in the Distance is a 20+ roleplay server, set in the Mega Man X timeline. We are a living and evolving alternate universe, giving players opportunities to introduce their own stories and expand on the MMX lore. We offer a mature, sandbox-style setting, with multiple open-ended plots, allowing players to meaningfully change the course of the Maverick Wars. We are new player-friendly! Prior knowledge of the MMX setting is not required. Canons, OCs and fangame characters are welcome! So come check us out!

Today's activity
22💬
11🟢
5👥
0📞
Server overview
49👥Total members
1📅years old
18+Age requirement
server profile pic
Øm̷n̷ɨvɇɍs̷a̷ł Ȼøłłɨs̷ɨøn̷
crossovermultiversemultiverse rproleplayroleplay crossover
Description

Somehow, World after World, it went black, straight after, characters from other worlds collided with a new world. These versions however, are unstable. Yet no one but the Vessels knew. A group who knows the real truth, and want to fix it. They believe there isn't much they can do, but maybe You can change that.

- Become a Vessel, a Citizen, A king. All roles are needed and can be played as much as possible.

- Participate as the main cast, or just roleplay for fun here.

- Fight or Help others, your free to choose.

- Explore around. Maybe you'll find a new place.

Hopefully you'll enjoy this server.

Today's activity
17💬
70🟢
9👥
0📞
Server overview
280👥Total members
1📅years old
15+Age requirement
server profile pic
Tales of Ideals
roleplaysuperherosuperheroes
user profile pic
the_sigg02-09-2024 13:23

Testing!

user profile pic
the_sigg02-09-2024 13:24

Hey there, get in!

Description

***For as long as humans have dreamed, we have dreamed of heroes.*** ***What if these dreams could come true? Could the world handle such power?*** ***These are...*** # _ _ _ _ 『 𝕋𝕒𝕝𝕖𝕤 𝕠𝕗 𝕀𝕕𝕖𝕒𝕝𝕤 』 _ _ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ Set in an alternate history version of our world, __**Tales of Ideals**__ tells the story of a world where superheroes have gone all but extinct. Following the destruction of much of civilization, society has lost faith in its protectors. In the United States, those that remain are under the watch of the **Superhuman Public Response** team. Now, in the year 2024, the balance of the world is in the hands of a new age of superheroes. Stagnant for decades, it is finally time for them to rise up again... but will they succeed? Will crime and villainy prevail at last? Or will this age die out before it gets going, and force the world to recover without supers? ### *The future is up to you!* _ _ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ## 𝓕𝓔𝓐𝓣𝓤𝓡𝓘𝓝𝓖: 💥 A world with decades of alternate history to discover! 🌎 Over **60** channels to roleplay in! 👊 The ability to create your own superheroes (or villains!) 🔥 A narrative focused approach, with an evolving world! ⚡ A class- & archetype-based system of character growth!

Today's activity
11💬
11🟢
3👥
0📞
Server overview
45👥Total members
1📅years old
18+Age requirement
server profile pic
Sousen - Fridge
roleplayanimemangarpjjkanime rpanime roleplayjujutsu kaisenjjk rpmanga rpjujutsu kaisen roleplayanime mangajjk roleplayjujutsu kaisen rp
Description

𝐽𝑈𝐽𝑈𝑇𝑆𝑈 𝑆𝑂𝑈𝑆𝐸𝑁 — 𝑅𝐸𝑉𝐸𝐿𝐴𝑇𝐼𝑂𝑁𝑆
⇢ 𝗟𝗢𝗢𝗞𝗜𝗡𝗚 𝗙𝗢𝗥 𝗛𝗘𝗜𝗔𝗡 𝗘𝗥𝗔 𝗝𝗝𝗞 𝗥𝗣?

⇢ Wanna host missions? Wanna make it to the top? And with no stat system, no starting off at the weakest you could possibly be, and both the ability to grow IRP, as well as not having to worry about overbearing restrictions that mess up your character's narrative, while doing so? Well, you're at the right place! Now, on to the actual ad...

⇢ Time comes for us all, no doubt, but death 𝘥𝘰𝘦𝘴 wait.

⇢ The world of jujutsu will never be the same again, not after 𝙩𝙝𝙞𝙨... because 𝙚𝙫𝙚𝙧𝙮𝙩𝙝𝙞𝙣𝙜 is on the brink of changing forever. The turn of the first millenium draws near, and... so much has been lost. The age old war between man and curse has reached its peak, unspeakable evils have been unleashed, and no man, woman or child in Japan has been spared from the consequences. This is the height of the Heian era, what will you do?

Today's activity
8💬
30🟢
4👥
0📞
Server overview
105👥Total members
2📅months old
13+Age requirement
server profile pic
R&Dé
communityroleplayboard gamesfrance
user profile pic
.tzen17-09-2024 17:22

Bonsoir à tous !

user profile pic
.tzen18-09-2024 09:27

Le Monopoly c'est super (non)

user profile pic
.tzen15-10-2025 10:28

Bienvenue à tous les créateurs et passionnés de jeux de société !

user profile pic
.tzen15-10-2025 18:55

Yoyoyo

user profile pic
.tzen16-10-2025 18:55

Jeux de soc.

user profile pic
.tzen17-10-2025 10:02

Bienvenue !

user profile pic
.tzen20-10-2025 18:20

Welcome all!

user profile pic
.tzen21-10-2025 14:10

Bienvenue à toutes et tous :)

user profile pic
.tzen21-10-2025 21:35

Bienvenue à toutes et tous :)

user profile pic
.tzen22-10-2025 10:11

yoyoyo

user profile pic
.tzen22-10-2025 21:17

oyo

user profile pic
.tzen23-10-2025 17:34

Yoyo

user profile pic
.tzen24-10-2025 15:12

YOyoyo

user profile pic
.tzen25-10-2025 11:51

yoyo

user profile pic
.tzen26-10-2025 11:18

yoyoyo

user profile pic
.tzen27-10-2025 18:38

Yoyo

user profile pic
.tzen29-10-2025 16:58

yoyoyoyo

user profile pic
.tzen31-10-2025 13:43

Yoyoyo

user profile pic
.tzen01-11-2025 13:32

Eyo

user profile pic
.tzen02-11-2025 13:16

yoyoyo

user profile pic
.tzen04-11-2025 12:02

Bonsoir

Description

🎲 Bienvenue sur R&Dé ! C'est LA communauté qui rapproche joueurs passionnés et créateurs chevronnés. Rejoignez des conversations animées sur les derniers jeux, découvrez des stratégies, échangez des astuces et trouvez des partenaires pour des parties endiablées. Nous organisons régulièrement des soirées de jeu, de création, des tournois et des événements spéciaux comme des game jams. Entrez dans la famille ludique R&Dé ! Tous : • partagez vos coups de cœurs • découvrez des nouveautés • trouvez des compagnons de jeu • jouez ensemble • partagez des stratégies • accès exclusif à des prototypes originaux Créateurs : • bénéficiez du retour des joueurs • demandez des conseils • partagez vos expériences Ensemble, inventons les classiques de demain ! Suivez-nous sur les réseaux et partagez à vos amis joueurs : • Twitch https://www.twitch.tv/rdegames • X TBD • Facebook TBD • Youtube TBD • Discord https://discord.gg/CFutHdqjRh

Today's activity
25💬
23🟢
4👥
0📞
Server overview
195👥Total members
1📅years old
13+Age requirement
Description

"You'll face death, and it won't be pretty.
Enough death to leave your broken, time and time again...."

Congratulations! The application you submitted to become a part of Project Epsilon has been accepted! Welcome aboard!

Hello and a warm welcome to Halo: Project Epsilon! This is a server where you take the role as an agent of Epsilon. You will embark on a whole variety of missions to various ancient and fantastical planets (created by yours truly) to combat the rising power of the evil Red Talon corporation. While working alone in this server is plausible, it is also foolish. We here at Epsilon are huge advocates for teamwork as it not only improves overall RP experience, but it also leads to more interesting and diverse scenarios for you and your new friends to enjoy. You heard me right, friends! Epsilon gladly welcomes anyone of any race, culture, background or identity, regardless of whether or not you are a member of the LGBTQ+ or if you are just an 8ft tall Sangheili, we are all friends here!

This is based on Red VS Blue’s project freelancer and is a custom rp server that involves:
- Team based mission RP 🕴️
- A competitive leaderboard to flex on all your pals 💪
- Frequent and inclusive events (nitro) 🫨
- Friendly staff who will be your new best friends 😎
- Acceptance of everyone, unless you are from Formby, which case I want my money back 🏳️‍🌈
- POKECORD 🦆
- Comedy 🤓
- Women (I think)🤷
- HUNGER GAMES! 🕺
- CQ Cumber 🐐
So if you like what I described and you think this server fits your vibe. Join! I would love to see you there and so would everyone else. If you still have any questions then all you got to do is ask me or our dedicated staff team (I love them) who will gladly offer assistance to solve any quibbles and quabbles you may have. I truly hope to see you there.

-Colorado

Today's activity
6💬
29🟢
3👥
0📞
Server overview
132👥Total members
5📅years old
13+Age requirement
server profile pic
Void's End|R2E Alpha
communitydark soulselden ringroleplayworld of warcraftwow
Description

Void's End is a roleplaying server with its own system inspired by world of warcraft, dark souls, and some other things. We accept suggestions to add more, come join us today!

Today's activity
226💬
7🟢
1👥
0📞
Server overview
15👥Total members
1📅years old
13+Age requirement
server profile pic
Water Time 💦
roleplaysocialchillfriendsanimehangoutminecraftfantasyliteratepoliticsgamesmusicartcommunitysfwfriendlygamingfunvoicedatingwritingfurry
Description

Let's keep connected! The focus of this server is to bring people together and build an exciting community! ✅

Today's activity
47💬
32🟢
1👥
0📞
Server overview
68👥Total members
2📅years old
13+Age requirement
Description

brilliant rp server with great staff!

Today's activity
28💬
25🟢
1👥
0📞
Server overview
74👥Total members
2📅years old
13+Age requirement
server profile pic
" Hold On " !! Detroit Become Human RP
dbhdetroit become humanroleplaydbh rpcommunitygamehangoutrp
Description

𖦹ㅤ ̼ ₊ㅤㅤLOADING. . . ㅤ ۪ ֹ

Detroit 2038. Technology has evolved to a point where human-like androids are everywhere. They speak, move and behave like human beings, but they are only machines serving humans. Play three distinct androids and see a world at the brink of chaos – perhaps our future - through their eyes

>﹒Main characters. Funny thing to call people. The world doesn't have main characters. They are just people that suffer and those who cause pain.

A free will. Yes, that's what is causing pain and chaos. There's no "choose" option anymore. There are just people and their will.

Think wisely. Nothing happens without a reason . . .

. . .
. . . . . .

> LOADING FINISHED

> PROCESS TO CONTINUE?
> YES > NO


⊹ ⠀࣪⠀ㅤㅤ ㅤ OUR OFFERT. . . ִ
> many free cc
> helpful crew including admins and mods
> chance to write your own storyline
> oc friendly
> safe community
> semi-lit / literate community
↷﹒⇆﹒

Today's activity
17💬
29🟢
2👥
0📞
Server overview
113👥Total members
11📅months old
13+Age requirement
Description

+ ━━━━☆ WELCOME TO THE GREENFIELD ACADEMY! ☆━━━━ +

Embark on a thrilling journey into the extraordinary at Greenfield Academy, where the year is 2044, and a new generation of heroes is rising. Dive into a captivating server where you have the power to shape your own original characters and unfold epic tales of heroism and discovery!

✨ Unleash Your Superhuman Potential ✨

Step into the bustling metropolis of Charter City, home to Greenfield Academy, a prestigious institution for molding future heroes. The students possess unique powers inherited from their grandparents who experienced an event known as "The Black Hole Incident." Explore a world where extraordinary abilities are the norm, and the line between hero and villain blurs.

🦸 Craft Your Heroic Legacy 🦸

Create your very own OC, from their compelling backstory to the depths of their superhuman abilities. Immerse yourself in a universe that celebrates originality, where your character's journey is untethered from existing storylines. Join forces with other members to weave tales of heroism, friendship, and self-discovery.

🚀 Soar Above the Rest 🚀

Here at Greenfield Academy, originality reigns supreme. Engage in a rich lore, explore diverse channels to enhance your OC's story, and immerse yourself in a non-toxic community that values creativity and collaboration. We understand the importance of real life, so join roleplays at your own pace without pressure.

What We Offer

- A unique roleplaying experience within the Greenfield Academy universe.
- Diverse channels for character development (Designs, Theme songs, Headcanons, Etc.).
- A welcoming and non-toxic community.
- Flexibility in roleplay participation, attend when you can.

Join us at Greenfield Academy, where destinies are forged, and the legacy of the next generation of heroes begins. Uncover your superhuman potential and let the adventure unfold!

Join the Journey Today!

Today's activity
9💬
32🟢
1👥
0📞
Server overview
98👥Total members
3📅years old
13+Age requirement
server profile pic
The Underverse
lgbtq+lgbtqialgbtqia+ roleplayroleplayunderfellundertaleunderverse
user profile pic
fell_sans_simp29-12-2023 22:24

Join for Undertale friends!!

Description

LOOKING FOR MODS!! 15+ ONLY SERVER! Please don't join if you're under 15. Hello! This is a new server that I created for all of the “weird kids” that never grew out of their Undertale phase. It's NOT just a roleplay server but there are roleplay channels for those interested! I worked really hard on it, so I'd really appreciate anyone who'd like to join and come hang out :3

Today's activity
9💬
17🟢
1👥
0📞
Server overview
93👥Total members
1📅years old
15+Age requirement
server profile pic
Booty Owl ✩₊˚.⋆☾𓅔☽⋆⁺₊✧
rpfantasyvchangoutcreativefriendlyfriendsfunchatart18+roleplaygamingchillactivesocialcommunity
user profile pic
vin873425-09-2025 13:40

welcome to the dumpster fire!

user profile pic
vin873422-10-2025 23:45

Happy Halloween 🖤🍁

Description

Welcome to the Booty Owl community! It's a galaxy far, far beyond Discord servers. May the owls be with you, always!

Today's activity
8💬
18🟢
1👥
0📞
Server overview
40👥Total members
1📅years old
18+Age requirement
server profile pic
PANDÆMONIUM: REBIRTH [BETA]
hazbin hotelhazbin hotel rphelluva bosshelluva boss rproleplay
user profile pic
bearerofbonez06-09-2025 21:48

We're finally up! Woo-hoo!

Description

# ⛧ | 𝓦𝓮𝓵𝓬𝓸𝓶𝓮 𝓽𝓸 𝓪 𝓷𝓮𝔀 𝓗𝓮𝓵𝓵. | ⛤
## ------------------------------------
***𝓗𝓮𝓵𝓵 𝓲𝓼 𝓲𝓷𝓯𝓲𝓷𝓲𝓽𝓮.*** Each possible land of the damned you could possibly imagine within a snowglobe on the desk of the Devil, so to speak.

His own daughter thought that perhaps redemption was an option for these damned souls, and Helel, stuck in his own ways, banished his own kin into the depths of hellfire he created.

But he was not careful as to which Hell he picked. Paranoid, he sent his right hand to oversee her. And as he expected, he witnessed her influence spreading to the Hell she now resided in, a Hell untouched for to long by Helel's governance. A Hell upturned. And now, a new variable was being added to the equation.

# 🖤 𝐈𝐬 𝐇𝐞𝐥𝐥 𝐭𝐫𝐮𝐥𝐲 𝐟𝐨𝐫𝐞𝐯𝐞𝐫?🌹

## ------------------------------------

Welcome, oh welcome, to PANDÆMONIUM: REBIRTH, a server where the destiny of the past is reforged and redemption is more possible than before. Now, this server is very different than other servers in that we operate on a server-only lore seperate from Hazbin Hotel and Helluva Boss. As such, I completely understand if you're uninterested in our server. But fear not! As disorienting as it may be, this means you can help expand the story with your own ideas! You can pull the reins and create the server's story alongside a welcoming community without the restrictions of canon!

Hopefully something like that is enticing. And if it is, we welcome you.

Today's activity
7💬
14🟢
2👥
0📞
Server overview
35👥Total members
3📅months old
18+Age requirement
server profile pic
Bakugan: Infinite Dimensions
bakuganbakugan battle brawlerspokemonroleplayyugioh
Description

Welcome to the world of Bakugan! This server is the perfect hangout spot for Bakugan fans and collectors all over the world. We have an optional roleplay that welcomes the use of OCs that takes place in an alternate timeline from the legacy anime series. You can expect: A helpful, supportive and inclusive group of people, Active members, Kind moderators who dont abuse power, Space to share your collections and memories, Opportunity to meet new people and make lasting friendships, Several bots to play with, and an optional semi-literate rp experience with a unique story and antagonist, the ability to create your own OCs, cards and bakugan, with fair and balanced game rules with a level up system based on the video game!

Today's activity
4💬
77🟢
4👥
1📞
Server overview
428👥Total members
3📅years old
13+Age requirement
server profile pic
Homework Helpers
communitysocialroleplaystudy
Description

Interact with fellow students and tutors to enjoy your stay in school! We share tips on how to balance work and attain academic achievement . Welcome to this beautiful experience!!!!

Today's activity
3💬
11🟢
3👥
0📞
Server overview
51👥Total members
2📅years old
18+Age requirement
Description

Little Heartaches, a little nightmares AU

After Six dropped Mono into the signal tower he became a slave to it, the thin man ensures that he can't leave the city. His only hope for escaping is a little girl called Noone, who saw something in the tower, something she wasn't supposed to see.

Six is far away from Pale City, aboard the Maw. She has no memory of Mono as all the pain and suffering Monos "betrayal" caused had made part of herself separate and become Shadow Six, who keeps Six from the truth and tries to distract her. Like bringing her to the Maw so she can find her long lost brother Seven, the runaway kid.

Otto continues his search for his long lost brother and sister (Mono and raincoat girl). He claims he's a specialist in dream psychology, and that he can cure nightmare disorder. Which gives him a steady supply of children

What we offer!
100s of RP channels with pictures pinned

Plot driven RP, this server will have on overarching story which everyone can be a part of, whether they're using ocs or cannons

The Sounds of Nightmares characters are claimable and we are(as far as I know) the first ln server to include them in the lore!

You can RP in and out of the Nowhere, patients and psychiatrists are allowed. Gatekeeper ocs are too!(a gatekeeper is basically like the candleman, taking kids across the threshold bla bla bla)

A welcoming and kind community (even if it's small)

We hope that you join, see you there!

Today's activity
3💬
20🟢
1👥
0📞
Server overview
49👥Total members
2📅years old
13+Age requirement
server profile pic
Dirac Sea
falling frontierroleplayspacethe expansethe sojourn
user profile pic
theonlychen29-08-2023 23:02

We are now cooking with Fusion Fuel

user profile pic
slava_rossii129-08-2023 23:05

This is Captain Lennox Kamal of the Martian Federal Navy, stop right there Rim Periphery Union scum!

user profile pic
aurai_the_trickster30-08-2023 01:51

Want to fire trash cannons and oversized flares at your enemies? Then the Snatchers have you covered!

user profile pic
slava_rossii130-08-2023 02:46

Can confirm, we have Amazon same day delivery services, and the package is a surprise until you join.

user profile pic
slava_rossii129-09-2023 06:12

Okay, ignore my review above, about time for a serious review. To put it simply this server is basically a spin off of The Expanse by James S.A. Corey. Some factions are basically rebranded versions of their factions in the books, such as IPA-UN, MF-MCR, BPU-OPA. On top of that there are unique factions with their own doctrine and technology to name them all, the Rim Periphery Union, and Kuiper Security Pact. Each has their own advantages and disadvantages, the players here do not need to worry about bullshit like shields that cancel out whatever you thrown at it and devolving into an endless argument about who has better technology. Only thing going on is your tactics, maneuvers and exploiting your own advantages and your enemies disadvantages

user profile pic
zolar15902-10-2023 07:29

l

Description

Dirac sea is a spacefaring roleplay and community inspired by the likes of The Expanse, Falling Frontier, and Nebulos fleet command. It is now the 25th century, and humanity has now long since left the confines of its home planet and have colonized vast swathes of the solar system. The invention of the epstien and wormhole jump drives has allowed travel times that would previously take years be done in a matter of weeks or even days, even as far as to help humanity verify the existence of planet 9, later colonized and named as Pales. However, as is typical with humanity and the conflicts they sow, summarized in the words of a asteroid belt miner: “Humanity had a garden that was filled with riches of water, air, and a blue sky. And yet, they not only almost destroyed that garden, they looked past the sky into the stars and beyond. And the first thought that came to their mind was not that of wonder or reverence, but one word: ‘Mine.’”

Today's activity
3💬
18🟢
1👥
0📞
Server overview
55👥Total members
2📅years old
13+Age requirement
server profile pic
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★
roleplaysocialcommunitychillanimehangoutcreativemangaliterateocbleachbleach rpbleach roleplayanime rpanime roleplaymanga rp
user profile pic
coolin.real15-11-2024 18:14

hi guys!

Description

[**``黒— ★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★``**] ***Join our server for an interesting run, an adventure throughout multiple different worlds and realms, a deeper perspective on several different races and untold stories in this entirely new world. You may fight strong opponents, take on new heights, push yourself beyond your limits and even face off against those above! With or without a purpose, be a an active participant in the lore of our server that revolves entirely on you all. Destroy the strongest hollows or even reapers, quincies, fullbringers, humans (hell anything you name it) this era has ever known or just simply do your own thing; Awaken a bankai, shoot arrows, become an espada or develop a mask! The opportunities are practically endless in this Mugetsu world! With several systems to guide your very actions and several people willing to rp with you where could things go wrong? immerse yourself in our very own Bleach universe, and interact with fellow fans. With engaging roleplay, thrilling storylines, and a welcoming community, this server is the ultimate destination for fans of all ages. Don't miss out on the chance to explore the vast world of Bleach and create unforgettable memories with like-minded enthusiasts. Join now and let’s start up this journey today, Karakura town is awaiting you!*** **Our own unique take on Bleach, you took the time to read this far so we KNOW you’re interested!** **``We offer: A forum based oc submission system where we can easily interact with you and point out certain details Several different templates for multiple different things such as weaponry, zanpakuto, and the different races showcased in the anime/manga! An active staff team The chance to influence the story or have your own arcs Be part of the main cast! Everyone is really, I mean it! A multitude of different systems for important techniques and skills such as the transformations (such as bankai, shikai, training, resurrecion and mastery) A lot of channels that give background information on what you can do with the bleach power systems so even if you haven’t actually seen the series or read the manga you could read up for a basic understanding! The chance to utilise cool transformations, zanpakuto's, kido spells, or even create your own Influence a moving plot a money system a moving story and a chance to give your own two cents``** ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Links: https://discord.gg/uKK8Q3nggG [let's go, your journey starts now!](https://tenor.com/bQ7nQ.gif) Pings: ||@everyone @here||

Today's activity
2💬
89🟢
2👥
0📞
Server overview
526👥Total members
1📅years old
13+Age requirement

211 servers found