Roleplay Discord servers

210 servers found

server profile pic
Oaths of Steel
roleplayroleplayinghouse of the dragongame of thrones
Description

🏰 Oaths of Steel | House of the Dragon RP 🐉

Enter the world of Westeros, where loyalties can shift like the wind and the bold carve their names into history.

🔥 Year 115 AC. The realm flourishes under the rule of Queen Vaelana Targaryen, First of Her Name. With dragons soaring above Westeros and noble houses vying for influence, the Iron Throne sits ever vulnerable to ambition, treachery, and blood.

Oaths of Steel is an immersive, literate roleplaying server set in the brutal and beautiful world of Game of Thrones / A Song of Ice and Fire (Set in the era of House of the Dragon). Whether you're a scheming noble in King’s Landing, a Night’s Watch ranger at the Wall, or a Knight claiming glory in battle — your story begins here.

🌐 What We Offer:

📜 Original Characters

🗺️ Detailed maps, custom lore channels, and deep worldbuilding.

⚔️ Political Intrigue & War

🐉 Player-driven plots with mod-run events and consequences.

🐺 All Houses Open (except Targaryen (for now!))

🕊️ LGBTQ+ friendly, 17+ community

🎭 Come if you love:

Deep character arcs

Strategic alliances & betrayal

Lore-rich fantasy settings

Join us. Swear your oath. Shape the realm.

"The game is yours to play — and the price is yours to pay."

Today's activity
4.9k💬
19🟢
17👥
0📞
Server overview
36👥Total members
3📅years old
17+Age requirement
server profile pic
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
1.7k💬
36🟢
19👥
9📞
Server overview
143👥Total members
2📅years old
14+Age requirement
Description

"You'll face death, and it won't be pretty.
Enough death to leave your broken, time and time again...."

Congratulations! The application you submitted to become a part of Project Epsilon has been accepted! Welcome aboard!

Hello and a warm welcome to Halo: Project Epsilon! This is a server where you take the role as an agent of Epsilon. You will embark on a whole variety of missions to various ancient and fantastical planets (created by yours truly) to combat the rising power of the evil Red Talon corporation. While working alone in this server is plausible, it is also foolish. We here at Epsilon are huge advocates for teamwork as it not only improves overall RP experience, but it also leads to more interesting and diverse scenarios for you and your new friends to enjoy. You heard me right, friends! Epsilon gladly welcomes anyone of any race, culture, background or identity, regardless of whether or not you are a member of the LGBTQ+ or if you are just an 8ft tall Sangheili, we are all friends here!

This is based on Red VS Blue’s project freelancer and is a custom rp server that involves:
- Team based mission RP 🕴️
- A competitive leaderboard to flex on all your pals 💪
- Frequent and inclusive events (nitro) 🫨
- Friendly staff who will be your new best friends 😎
- Acceptance of everyone, unless you are from Formby, which case I want my money back 🏳️‍🌈
- POKECORD 🦆
- Comedy 🤓
- Women (I think)🤷
- HUNGER GAMES! 🕺
- CQ Cumber 🐐
So if you like what I described and you think this server fits your vibe. Join! I would love to see you there and so would everyone else. If you still have any questions then all you got to do is ask me or our dedicated staff team (I love them) who will gladly offer assistance to solve any quibbles and quabbles you may have. I truly hope to see you there.

-Colorado

Today's activity
34💬
27🟢
6👥
0📞
Server overview
133👥Total members
6📅years old
13+Age requirement
Description

𝐒𝐄𝐕𝐄𝐍.. 𝐒𝐈𝐗... 𝐄𝐋𝐄𝐕𝐄𝐍... 𝐅𝐈𝐕𝐄... 𝐍𝐈𝐍𝐄 𝐀𝐍' 𝐓𝐖𝐄𝐍𝐓𝐘 𝐌𝐈𝐋𝐄 𝐓𝐎-𝐃𝐀𝐘... 𝐅𝐎𝐔𝐑... 𝐄𝐋𝐄𝐕𝐄𝐍.. 𝐒𝐄𝐕𝐄𝐍𝐓𝐄𝐄𝐍.. 𝐓𝐇𝐈𝐑𝐓𝐘-𝐓𝐖𝐎 𝐓𝐇𝐄 𝐃𝐀𝐘 𝐁𝐄𝐅𝐎𝐑𝐄..

⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆
est. 7th November 2023. The most long lasting, active vibey aot rp server you'll ever find. **SERVER TAG + EXCLUSIVE ROLES!!** ( and 24/7 poketwo)

Interested in joining a chill out aot rp server on disc thats also active, with amazing and hilarious (and actual NON toxic) members? This server supports all styles of RPing. Here's why you should join:
╰┈➤There are SO many available canon characters to choose from, (and by choosing a canon, you're also guaranteed a unique role, [yes- even the "minor side characters"] no service required!) and we LOVE OCs!! There are many activities that take place including royal balls/galas, battles, path sequences and so much more.. and even an actor au! ╰┈➤The server allows you to focus on your character as well as their interactions with others. NO ONE is ever left out in the plot.
╰┈➤Choose where your character comes from (if an OC) I.E Marleyan or Eldian. There are loads and loads of different channels, (including Marley, beyond the walls, and more!) This server also doesn't have an over-the-top combat system or rules, you can go crazy! (just not OP.)
╰┈➤The plot has a perfect balance of comedy, combat, romance, serious RP and many tear jerking moments.
╰┈➤ This server is perfect for any RPer who is just starting out, getting back into the fandom, or just wants a chance to show off some writing. But wait, there's more!
╰┈➤ We don't just do RP here. We have regular silly VC's, music nights, game streams, UNO, and many more! With that said, thank you so much and I know we'll all be able to give eachother a memorable RP experience!
⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆

𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒... 𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒.. 𝐌𝐎𝐕𝐈𝐍' 𝐔𝐏 𝐀𝐍' 𝐃𝐎𝐖𝐍 𝐀𝐆𝐀𝐈𝐍.. 𝐓𝐇𝐄𝐑𝐄'𝐒 𝐍𝐎 𝐃𝐈𝐒𝐂𝐇𝐀𝐑𝐆𝐄 𝐈𝐍 𝐓𝐇𝐄 𝗪𝐀𝐑.

Today's activity
4.5k💬
95🟢
52👥
0📞
Server overview
452👥Total members
2📅years old
13+Age requirement
server profile pic
|| JJK || The Jujutsu Experience
jjkjjk roleplayjjk rpjujutsu kaisenjujutsu kaisen roleplayjujutsu kaisen rproleplay
user profile pic
gumeybear2122-09-2024 13:04

a

Description

The Jujutsu Experience! It's a roleplaying/hangout JJK server!! Your oc's make the future! It's simple and an up n' coming server. - Cannon Techniques to be claimed by YOUR ocs ;o - Friendly staff (I think I'm friendly anyways) - Easy to understand templates - Sukuna's vessel up for grabs >:)) So why don't you come on down and join! Even if you just want to hangout and chat, that's what we're here for, but if you want to rp, come make an oc that'll shape the lore of the server!

Today's activity
8💬
81🟢
4👥
0📞
Server overview
308👥Total members
1📅years old
13+Age requirement
server profile pic
It's Your Power!
roleplayrpmhamy hero academiamha-rproleplayingmy hero academia-roleplay)my hero academia-rppartnership
Description

🌟 IT’S YOUR POWER! — MY HERO ACADEMIA RP 🌟

🦸‍♂️ Do you have a hero OC?
🦹 A villain with a cause?
👤 Or a civilian just trying to survive in a superpowered world?

It’s Your Power! is a My Hero Academia–based roleplay server set in a post-war, hybrid timeline, where hero society is rebuilding—and redefining itself.

In this world, most humans possess Quirks, superhuman abilities that shape daily life, careers, and conflict. Hero schools still stand, villains still lurk, and the line between right and wrong has never been thinner.

What sets us apart?

✨ Play who you want.
You’re not limited to hero students. Play:
Hero students, Pro Heroes, Villains, Vigilantes, Civilians, Support and business roles
…and more.

🏫 Multiple Hero Schools

U.A. High School

Shiketsu High School

Deika City University (DCU) — a bold, experience-first hero institution

📖 Story-Driven World
The world reflects the consequences of canon events, while leaving room for player-driven stories, growth, and server-wide arcs.

🌈 Inclusive & Community-Focused
Whether you’re here for intense plots, character development, or casual RP, there’s a place for you.

🔹 What We Offer:

• Friendly and welcoming community
• Clear rules and active staff
• Self-assignable roles
• Open RP channels (no forum locking)
• RP events and story arcs
• LGBTQ+ friendly environment
• Unlimited original characters
• Canon characters available to claim
• Partnerships welcome

Step into a world where power doesn’t define destiny.

It’s not about the Quirk you’re born with.
It’s about what you choose to do with it.

💥 It’s Your Power! 💥

Today's activity
1.2k💬
29🟢
37👥
1📞
Server overview
71👥Total members
2📅months old
15+Age requirement
server profile pic
DECEIT [RP]
communityroleplayrp
Description

˗ˏˋ ✞ ˎˊ˗ 𝐃𝐄𝐂𝐄𝐈𝐓 ˗ˏˋ ✞ ˎˊ˗ “I will not tell you the visceral details as you already know them, you all do. It's happening to every-body.”
═══════════════
On the eve of the outbreak, Southwood, Alabama's population sat at 8,000. Now? hundreds, a bustling coastal city transformed into nothing more than a shell of it's former glory. It wasn't always this way, yet an inconceivable turn of events left thousands wondering if hope was well and truly lost. You weren't lucky enough to be picked up by the military convoys that left town at the behest of the United States Government, no, you were left behind, discarded, and no matter how unhappy you were about that fact, nothing could change how you were now among Fairhope's last remaining inhabitants. There was no telling just what could happen, the cataclysm of the world as we know it was sure to bring about some major changes. Were you going to embrace it, or desperately cling onto whatever hope humanity had left..?
═══════════════
“No-one you know is a good person.”
═══════════════
What Deceit Offers... {✞}

HORROR + APOCALYPTIC THEMES — Built by a team of previous apocalypse-RPers, Deceit offers a range of apocalyptic themes within it's plotlines, all based in the fictional coastal town of Southwood, Alabama . We don't merely focus on the dark, gritty aspects of the apocalypse, but also the wider picture. We aim to make our world as immersive as possible so that everyone can get the most enjoyment out of roleplaying here.

{✞} CREATIVE SPACE FOR ALL SKILL-LEVELS — With the rise in AI over recent years, we've noticed a severe lack in creative spaces. Deceit offers a creative outlet for writers of all skill-levels, whether you're literate writer who wants to improve their work, or a multi-paragraph writer who wants to tell an immersive story, there's a place for you here. AI is banned entirely.

{✞} INTERACTIVE LORE — We've implemented not only a D20 system, but also certain guidelines for events that mean your choices matter. There are real stakes behind every choice your character makes, meaning every single session carries a unique sort of tension. {✞} MEMBER FEEDBACK — Ultimately, we are not immune to taking criticism. If there are certain aspects of the server that you think could be improved upon, then tell us so we can ensure a positive experience for everyone.
═══════════════

Today's activity
1.5k💬
23🟢
13👥
7📞
Server overview
42👥Total members
2📅years old
13+Age requirement
server profile pic
R&Dé
communityroleplayboard gamesfrance
user profile pic
.tzen17-09-2024 17:22

Bonsoir à tous !

user profile pic
.tzen18-09-2024 09:27

Le Monopoly c'est super (non)

user profile pic
.tzen15-10-2025 10:28

Bienvenue à tous les créateurs et passionnés de jeux de société !

user profile pic
.tzen15-10-2025 18:55

Yoyoyo

user profile pic
.tzen16-10-2025 18:55

Jeux de soc.

user profile pic
.tzen17-10-2025 10:02

Bienvenue !

user profile pic
.tzen20-10-2025 18:20

Welcome all!

user profile pic
.tzen21-10-2025 14:10

Bienvenue à toutes et tous :)

user profile pic
.tzen21-10-2025 21:35

Bienvenue à toutes et tous :)

user profile pic
.tzen22-10-2025 10:11

yoyoyo

user profile pic
.tzen22-10-2025 21:17

oyo

user profile pic
.tzen23-10-2025 17:34

Yoyo

user profile pic
.tzen24-10-2025 15:12

YOyoyo

user profile pic
.tzen25-10-2025 11:51

yoyo

user profile pic
.tzen26-10-2025 11:18

yoyoyo

user profile pic
.tzen27-10-2025 18:38

Yoyo

user profile pic
.tzen29-10-2025 16:58

yoyoyoyo

user profile pic
.tzen31-10-2025 13:43

Yoyoyo

user profile pic
.tzen01-11-2025 13:32

Eyo

user profile pic
.tzen02-11-2025 13:16

yoyoyo

user profile pic
.tzen04-11-2025 12:02

Bonsoir

user profile pic
.tzen10-11-2025 12:48

yoyo

user profile pic
.tzen11-11-2025 12:23

yo

user profile pic
.tzen12-11-2025 13:01

Bienvenue !

user profile pic
.tzen12-11-2025 20:44

Yoyo

user profile pic
.tzen13-11-2025 16:37

yoyo

user profile pic
.tzen13-11-2025 21:15

Bonsoir.

user profile pic
.tzen17-11-2025 19:59

Yo!

user profile pic
.tzen19-11-2025 11:42

yoyo

user profile pic
.tzen21-11-2025 14:46

|

user profile pic
.tzen25-11-2025 18:03

Yoyo

user profile pic
.tzen26-11-2025 13:54

Yoy

user profile pic
.tzen27-11-2025 19:10

Bonsoir!

user profile pic
.tzen28-11-2025 14:05

Yoyoyo

user profile pic
.tzen01-12-2025 21:59

Yoyo

user profile pic
.tzen02-12-2025 12:40

YOyo

user profile pic
.tzen02-12-2025 17:28

Yoyoyo

user profile pic
.tzen03-12-2025 12:57

Yoyo

user profile pic
.tzen05-12-2025 15:08

Yoyo

user profile pic
.tzen05-12-2025 22:01

Yoyoyo

user profile pic
.tzen14-12-2025 18:24

Upupp

user profile pic
.tzen17-12-2025 14:32

Yoyo

user profile pic
.tzen19-12-2025 21:04

Yoyo

user profile pic
.tzen23-12-2025 12:39

yo

user profile pic
.tzen24-12-2025 15:33

yoyo

user profile pic
.tzen26-12-2025 16:11

yoyo

user profile pic
.tzen27-12-2025 14:32

Bienvenue !

user profile pic
.tzen06-01-2026 11:06

yoYO

user profile pic
.tzen08-02-2026 17:58

Bonsoir!

Description

🎲 Bienvenue sur R&Dé ! C'est LA communauté qui rapproche joueurs passionnés et créateurs chevronnés. Rejoignez des conversations animées sur les derniers jeux, découvrez des stratégies, échangez des astuces et trouvez des partenaires pour des parties endiablées. Nous organisons régulièrement des soirées de jeu, de création, des tournois et des événements spéciaux comme des game jams. Entrez dans la famille ludique R&Dé ! Tous : • partagez vos coups de cœurs • découvrez des nouveautés • trouvez des compagnons de jeu • jouez ensemble • partagez des stratégies • accès exclusif à des prototypes originaux Créateurs : • bénéficiez du retour des joueurs • demandez des conseils • partagez vos expériences Ensemble, inventons les classiques de demain ! Suivez-nous sur les réseaux et partagez à vos amis joueurs : • Twitch https://www.twitch.tv/rdegames • X TBD • Facebook TBD • Youtube TBD • Discord https://discord.gg/CFutHdqjRh

Today's activity
6💬
18🟢
4👥
0📞
Server overview
208👥Total members
1📅years old
13+Age requirement
server profile pic
city in the sky · fluffy tag
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
1.2k💬
384🟢
74👥
0📞
Server overview
2.8k👥Total members
1📅years old
13+Age requirement
server profile pic
The Writer's Library {{21+}}
friendlysocialroleplayrpcommunitywritingroleplayerroleplay partnerwritersactive
Description

Welcome to the Writers Library. All writing levels are welcome! We are a 21+ Role Play server. We do request your work be human written. Here you can find yourself lost in the pages of your own creations and meet other writers to join you.

Today's activity
4.5k💬
105🟢
63👥
6📞
Server overview
327👥Total members
5📅months old
21+Age requirement
server profile pic
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
910💬
73🟢
36👥
0📞
Server overview
406👥Total members
3📅years old
16+Age requirement
server profile pic
RP n’ Chill
role-playroleplay
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
894💬
177🟢
31👥
1📞
Server overview
1.1k👥Total members
5📅years old
15+Age requirement
server profile pic
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
2.6k💬
68🟢
29👥
13📞
Server overview
1.2k👥Total members
3📅years old
13+Age requirement
server profile pic
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
709💬
2.1k🟢
47👥
9📞
Server overview
12.3k👥Total members
9📅years old
13+Age requirement
server profile pic
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
1.3k💬
73🟢
24👥
0📞
Server overview
232👥Total members
2📅years old
13+Age requirement
server profile pic
/saucee | ask2dm • egirls • dating • social • active
socialcommunitychillroleplaygamesanimefriendsactivemoviesdatingegirledatingfreakyactive-voicechat
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
683💬
171🟢
169👥
5📞
Server overview
2.1k👥Total members
1📅years old
18+Age requirement
server profile pic
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★
roleplaysocialcommunitychillanimehangoutcreativemangaliterateocbleachbleach rpbleach roleplayanime rpanime roleplaymanga rp
user profile pic
coolin.real15-11-2024 18:14

hi guys!

Description

[**``黒— ★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★``**] ***Join our server for an interesting run, an adventure throughout multiple different worlds and realms, a deeper perspective on several different races and untold stories in this entirely new world. You may fight strong opponents, take on new heights, push yourself beyond your limits and even face off against those above! With or without a purpose, be a an active participant in the lore of our server that revolves entirely on you all. Destroy the strongest hollows or even reapers, quincies, fullbringers, humans (hell anything you name it) this era has ever known or just simply do your own thing; Awaken a bankai, shoot arrows, become an espada or develop a mask! The opportunities are practically endless in this Mugetsu world! With several systems to guide your very actions and several people willing to rp with you where could things go wrong? immerse yourself in our very own Bleach universe, and interact with fellow fans. With engaging roleplay, thrilling storylines, and a welcoming community, this server is the ultimate destination for fans of all ages. Don't miss out on the chance to explore the vast world of Bleach and create unforgettable memories with like-minded enthusiasts. Join now and let’s start up this journey today, Karakura town is awaiting you!*** **Our own unique take on Bleach, you took the time to read this far so we KNOW you’re interested!** **``We offer: A forum based oc submission system where we can easily interact with you and point out certain details Several different templates for multiple different things such as weaponry, zanpakuto, and the different races showcased in the anime/manga! An active staff team The chance to influence the story or have your own arcs Be part of the main cast! Everyone is really, I mean it! A multitude of different systems for important techniques and skills such as the transformations (such as bankai, shikai, training, resurrecion and mastery) A lot of channels that give background information on what you can do with the bleach power systems so even if you haven’t actually seen the series or read the manga you could read up for a basic understanding! The chance to utilise cool transformations, zanpakuto's, kido spells, or even create your own Influence a moving plot a money system a moving story and a chance to give your own two cents``** ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Links: https://discord.gg/uKK8Q3nggG [let's go, your journey starts now!](https://tenor.com/bQ7nQ.gif) Pings: ||@everyone @here||

Today's activity
5💬
125🟢
4👥
0📞
Server overview
501👥Total members
1📅years old
13+Age requirement
Description

***TOKYO GHOUL - TRIBUTES***

*This server is 16+!*
It is modern day Tokyo. Years have passed since the Dragon War. Faux allyships between Ghoul and Mankind have crumbled like castles under poor leadership and glorified silver linings. From the ashes rose tired, angry, and vengeful ghouls that were given fragile promises and hope at living a normal life.

The United Front and newly-instated CCG, lead by Matsuri Washuu, are now at war. The CCG believes that it is their rightful title as Japan's proper justice division and that all ghouls must be executed as a means to prevent a third-wave’s occurrence as well as another Dragon Incident. The wards have been distorted in chaos underneath the surface, as constant warring over Tokyo's wards appears to be never-ending.

The strange world just got stranger. The dead are mysteriously rising, old organizations are returning with new faces and new leadership, and the ghoul and human worlds as we know it are headed for significant changes.

Here there is a very lax ranking system, meaning that, until the free-spots are filled for higher ranking ghouls / investigators you may have to have your character be higher ranked. For those that miss out, do not fret. We are solely-activity based, meaning the longer / more active you are the higher the rank you can become via the Arcane bot level system **in roleplay channels only**. Both canons and original characters are welcome. Create your own paths - your lore is incorporated into the server's lore. Have fun and enjoy your stay!

*What we offer*

- Unlimited OCs
- A complete, unique server with all 24 wards and location channels within them
- Semi-lit - Adv. Lit RP
- A small but growing community of friendly, creative people
- Canon Character roles
- Gartic, music bots and streaming voice chats

Today's activity
277💬
11🟢
4👥
0📞
Server overview
32👥Total members
2📅years old
16+Age requirement
server profile pic
Divinity's Rapture
communityroleplayroleplayingchillsocialanimelgbtq+fireemblemfe3h18+anime rp
Description

(SFW RP, but hidden ooc nsfw channel)

(Past and "modern" versions of characters are, essentially, separate people, and exist at the same time.)

The year is 1885, nearly 700 years after the War of Unification for Fódlan. Peace and prosperity reigned across the land as students far and wide made their way to the esteemed officers academy. A professor awaits for a new opportunity to teach as three important heirs make their way to Garreg Mach alongside their comrades. Little did any of them know however the peace they knew would come crashing down. Those from the past arrived both friend and foe. While the newly lost Fell Star seeks to restore balance and preserve this world the King of Liberation and his allies move to conquer and destroy. For the past was never meant to encounter the future and the dead should have been left to rest. Memories blur as the inhabitants of Garreg Mach attempt to understand who they are and what this all entails.

(Welcome to Divinity’s Rapture! An FE3H time travel au featuring the messy attempts at finding a perfect ending and the consequences that follow. Follow the story as the past is flung into an alternate far future all while reality desperately attempts to piece itself together. )

Today's activity
236💬
17🟢
10👥
0📞
Server overview
39👥Total members
10📅months old
18+Age requirement
server profile pic
Rus' | Into The Frost
adventurefantasymedievalroleplay
Description

With a long winter preparing to encapsulate the Tsardom of Rus' and all living things within the Russkaya Zemlya, we invite you to join us in the new and improved Rus' Universe. Dobro pozhalovat' v Rus! Welcome to the Rus', my friend. The "Rus' | Into The Frost" is a server based on 15th-Century Medieval Russia with a fantasy twist. Imagine a world where legendary creatures found in traditional folklore coexisted alongside ManKind. It is in our universe that adventurers from all corners of the globe travel to the Land of the Rus' to test their mettle against the ferocious beasts that dominate the cold lands. Limited by only your own brilliant creativity, you are allowed to start off as a majestic and nimble Kitsune from the Far East—using magic to turn your foes to dust. You can even try to slay beasts as an Elven Archer from the Germanic Region who can strike down their prey from miles away, a werewolf, vampire, orc, and so much more. Don't be afraid to strive for whatever your artistic mind desires. This is a community that accepts all passionate to write, role-play, and help build an immersive universe influenced by its members and everything we do as a community. Upon joining, we ask that you take the time to read the instructions provided in our welcome channel. We are a very well-written and fleshed-out server. We hope that you'll be joining us very soon on our courageous adventures, friend.

Today's activity
162💬
16🟢
8👥
0📞
Server overview
41👥Total members
3📅years old
18+Age requirement
server profile pic
𝗗𝟰
communitysocialchillroleplaygaminggameshangoutanimefriendsfunfriendlyartchatmusicvcactiverobloxminecraftsfwlgbtq+memesrpmangaeventspoliticsvaloranthorrorenglishnon-toxicprogrammingaianime rpegirlsreading13+lgbtqcatsteenbookslgbtq friendlyactive-communityfootballvoice chatsportstechnologycutegamersnontoxicbookclubgtaegirlteensmusic producersgoofymusicianweedartsadultsemojiapexvoice-chattechnicalraidsgamergame nightsfun factshang outvaporwavegame-devlgbtq+ friendlyactive voice chatno toxicitygta vdeveloperspersonal developmentmusic botsemotomb-raiderclassical musiceboystechsoccerstorysocial community vc fun friendlylgbt friendlysmokingteen-friendlyactive-voicechat420house of the dragonanime rpgvcsemojisraidingskateboardinggamer-girlsweebnukevapingeboyd4gamer-girlskatingscooterraiderssk8stonervaporprogrammersskatergamergirl
Description

𝗗𝟰 𝗶𝘀 𝘁𝗮𝗶𝗹𝗼𝗿𝗲𝗱 𝘁𝗼 𝗮𝗹𝗹 𝗽𝗲𝗼𝗽𝗹𝗲 𝘄𝗵𝗼 𝗷𝗼𝗶𝗻.
● sғᴡ → ᴀʀᴛ
● ᴛᴇᴄʜ → ᴀɴɪᴍᴇ
● ᴍᴜsɪᴄ → ᴍᴇᴍᴇs
● ᴇᴠᴇɴᴛs → sᴏᴄɪᴀʟ
● ᴀᴄᴛɪᴠᴇ → ᴠᴀᴘᴇʀs
● ᴇ-ʙᴏʏs → ʜɪᴘᴘɪᴇs
● ɢᴀᴍɪɴɢ → ᴇ-ɢɪʀʟs
● sᴋᴀᴛᴇʀs → sᴛᴏɴᴇʀs
● ᴇǫᴜᴀʟɪᴛʏ → ᴀᴛʜʟᴇᴛᴇs
● ᴍᴜsɪᴄɪᴀɴs → sᴛʀᴇᴀᴍɪɴɢ
● ʀᴀᴘ-ʙᴀᴛᴛʟᴇs→ ɴᴏɴ-sᴛᴏɴᴇʀs
● ᴘʀᴏɢʀᴀᴍᴍɪɴɢ → ᴄʏʙᴇʀ-sᴇᴄᴜʀɪᴛʏ
● ᴄᴀᴛᴄʜɪɴɢ-ᴘᴇᴅᴏs → ғʀᴇᴇ-ᴇxᴘʀᴇssɪᴏɴ
● ᴀɴᴛɪ-ᴄᴏʀʀᴜᴘᴛɪᴏɴ → ᴍᴜsɪᴄ-ᴘʀᴏᴅᴜᴄᴇʀs
● ᴄᴏɴᴛᴇɴᴛ -ᴄʀᴇᴀᴛᴏʀs → ᴘᴏᴇᴛʀʏ ᴀɴ ǫᴜᴏᴛᴇs
𝗧𝗵𝗲 𝗽𝗲𝗿𝗳𝗲𝗰𝘁 𝗽𝗹𝗮𝗰𝗲 𝗳𝗼𝗿 𝗺𝗲𝗲𝘁𝗶𝗻𝗴 𝗻𝗲𝘄 𝗽𝗲𝗼𝗽𝗹𝗲 𝗲𝘃𝗲𝗿𝘆𝗱𝗮𝘆.

NON-TOXIC

Today's activity
704💬
132🟢
42👥
17📞
Server overview
661👥Total members
9📅months old
13+Age requirement
server profile pic
Tales of Ideals
roleplaysuperherosuperheroes
user profile pic
the_sigg02-09-2024 13:23

Testing!

user profile pic
the_sigg02-09-2024 13:24

Hey there, get in!

Description

***For as long as humans have dreamed, we have dreamed of heroes.*** ***What if these dreams could come true? Could the world handle such power?*** ***These are...*** # _ _ _ _ 『 𝕋𝕒𝕝𝕖𝕤 𝕠𝕗 𝕀𝕕𝕖𝕒𝕝𝕤 』 _ _ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ Set in an alternate history version of our world, __**Tales of Ideals**__ tells the story of a world where superheroes have gone all but extinct. Following the destruction of much of civilization, society has lost faith in its protectors. In the United States, those that remain are under the watch of the **Superhuman Public Response** team. Now, in the year 2024, the balance of the world is in the hands of a new age of superheroes. Stagnant for decades, it is finally time for them to rise up again... but will they succeed? Will crime and villainy prevail at last? Or will this age die out before it gets going, and force the world to recover without supers? ### *The future is up to you!* _ _ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ## 𝓕𝓔𝓐𝓣𝓤𝓡𝓘𝓝𝓖: 💥 A world with decades of alternate history to discover! 🌎 Over **60** channels to roleplay in! 👊 The ability to create your own superheroes (or villains!) 🔥 A narrative focused approach, with an evolving world! ⚡ A class- & archetype-based system of character growth!

Today's activity
32💬
19🟢
6👥
0📞
Server overview
44👥Total members
1📅years old
18+Age requirement
server profile pic
Fluid Client
communitysocialactivechillroleplaygaminghangoutgamescreativefriendsfunfriendlyartchatmusicvcsfwrobloxminecraft
Description

Ready to take your Minecraft adventures to the next level? Fluid Client, the unrivaled Minecraft client for 1.8.9, is your ticket to endless possibilities! 🌍 Unleash your imagination, conquer challenges, and build your way to victory! Download now at https://fluidclient.ovh/download.

Today's activity
47💬
587🟢
24👥
1📞
Server overview
10.3k👥Total members
2📅years old
13+Age requirement
server profile pic
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥
dungeons and dragonsd&dttrpghobbiesdndtabletoproleplay
Description

The City of Brass is a place for people to share and discuss their hobbies, favorite media, and worldbuilding projects; whether it be for a tabletop game like Dungeons and Dragons, or just for the fun of it! We also like to make and give/receive feedback on Hombrew content for D&D!

Today's activity
41💬
29🟢
8👥
0📞
Server overview
83👥Total members
4📅years old
18+Age requirement
server profile pic
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
572💬
52🟢
12👥
0📞
Server overview
197👥Total members
3📅years old
13+Age requirement
server profile pic
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
19💬
27🟢
9👥
0📞
Server overview
153👥Total members
4📅years old
15+Age requirement
Description

ꕤ˖⸝⸝₊˚ Heiwa: 𝐆𝐨𝐥𝐝𝐞𝐧 𝐅𝐚𝐭𝐞 — a Medieval Fantasy Roleplay Server Long ago, the Epoch Shift shattered history; revealing a hidden orange-glowing moon, Nimiel, and changing the world as we know it. Civilizations now rise from the ruins, rediscovering old gods, lost kingdoms, and mysterious crystals embedded deep within the land. Ecosystems evolving far faster than we can keep up with, people redefining themselves and their lives. In this world, magic is a muscle, not an infinite force. Each spell strains the body. Power comes from training, endurance, and discipline. Your story begins here - when anything and everything you do can change the course of the story, how will you choose to live? 𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃 Heiwa is currently in a TRIAL PHASE. From now until NEW YEARS, the server is open for character-making and roleplaying, but no important lore events will occur. If you want to get in to make a mark before we truly kick off, now is the time! Deep, original lore (two moons, a shattered epoch, divine politics, unique magic system) Friendly, active community OC-focused, literate & semi-literate roleplay Medieval fantasy aesthetic Multiple regions, factions, and cultural paths Helpful staff, open channels for new players Event-driven storytelling + player-driven plots Safe, welcoming environment for all Ready to step into the new era? Join the world shaped by Mōna and awakened by Nimiel. Your story awaits.

Today's activity
26💬
44🟢
6👥
7📞
Server overview
112👥Total members
3📅months old
13+Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
3.8k💬
97🟢
45👥
0📞
Server overview
693👥Total members
6📅years old
14+Age requirement
server profile pic
Dragon Ball Finality
communityroleplayvoicedbzdbdragon ball
Description

🌌 DRAGON BALL FINALITY 🌌
An 18+ literate, stat-based roleplay server

📜 The Setting
Age 430 — the Earth is raw and untamed.
No capsules, no space travel — only scattered kingdoms, hidden dojos, and wandering martial artists. Ki is rare, magic is feared, and demons stalk the shadows. Every punch, every beam, every choice shapes history.

⚔️ Plot System
» A-Plots – Admin-led, canon, world-shaking.
» B-Plots – Player + admin collab, canon, medium scale.
» C-Plots – Player-run, flexible, fun, sometimes canon.

✨ Features
» Unique stat-based combat system (Ki • Effort • Magic).
» Automation bots keep fights fast & fair.
» OC-driven stories – forge your own legend.
» 18+ only, zero-tolerance for harassment.

👊 Will you fight for glory, survival, or something greater?
The World is waiting.

Today's activity
11💬
21🟢
5👥
0📞
Server overview
39👥Total members
7📅months old
18+Age requirement
server profile pic
the Eternity
horrorroleplaywriting
Description

a new, somewhat horror based rp server set in a luxury hotel. Ocs and canon characters are allowed. We're just starting off, so join now!

Today's activity
9💬
9🟢
5👥
0📞
Server overview
17👥Total members
2📅years old
16+Age requirement
server profile pic
Avalon Community | Dedicated Servers & Real Players
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
104💬
134🟢
12👥
0📞
Server overview
1.0k👥Total members
8📅years old
13+Age requirement
server profile pic
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
876💬
860🟢
57👥
8📞
Server overview
5.8k👥Total members
5📅years old
13+Age requirement
server profile pic
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
135💬
30🟢
11👥
0📞
Server overview
133👥Total members
1📅years old
16+Age requirement
server profile pic
Dirac Sea
falling frontierroleplayspacethe expansethe sojourn
user profile pic
theonlychen29-08-2023 23:02

We are now cooking with Fusion Fuel

user profile pic
slava_rossii129-08-2023 23:05

This is Captain Lennox Kamal of the Martian Federal Navy, stop right there Rim Periphery Union scum!

user profile pic
aurai_the_trickster30-08-2023 01:51

Want to fire trash cannons and oversized flares at your enemies? Then the Snatchers have you covered!

user profile pic
slava_rossii130-08-2023 02:46

Can confirm, we have Amazon same day delivery services, and the package is a surprise until you join.

user profile pic
slava_rossii129-09-2023 06:12

Okay, ignore my review above, about time for a serious review. To put it simply this server is basically a spin off of The Expanse by James S.A. Corey. Some factions are basically rebranded versions of their factions in the books, such as IPA-UN, MF-MCR, BPU-OPA. On top of that there are unique factions with their own doctrine and technology to name them all, the Rim Periphery Union, and Kuiper Security Pact. Each has their own advantages and disadvantages, the players here do not need to worry about bullshit like shields that cancel out whatever you thrown at it and devolving into an endless argument about who has better technology. Only thing going on is your tactics, maneuvers and exploiting your own advantages and your enemies disadvantages

user profile pic
zolar15902-10-2023 07:29

l

Description

Dirac sea is a spacefaring roleplay and community inspired by the likes of The Expanse, Falling Frontier, and Nebulos fleet command. It is now the 25th century, and humanity has now long since left the confines of its home planet and have colonized vast swathes of the solar system. The invention of the epstien and wormhole jump drives has allowed travel times that would previously take years be done in a matter of weeks or even days, even as far as to help humanity verify the existence of planet 9, later colonized and named as Pales. However, as is typical with humanity and the conflicts they sow, summarized in the words of a asteroid belt miner: “Humanity had a garden that was filled with riches of water, air, and a blue sky. And yet, they not only almost destroyed that garden, they looked past the sky into the stars and beyond. And the first thought that came to their mind was not that of wonder or reverence, but one word: ‘Mine.’”

Today's activity
59💬
19🟢
1👥
0📞
Server overview
60👥Total members
2📅years old
13+Age requirement
server profile pic
𝐕𝐞𝐫𝐢𝐝𝐚𝐧 𝐇𝐢𝐥𝐥 𝐀𝐜𝐚𝐝𝐞𝐦𝐲
dark academiahigh school roleplayroleplaysemi-litslice of life
Description

: 𝐂𝐨𝐧𝐠𝐫𝐚𝐭𝐮𝐥𝐚𝐭𝐢𝐨𝐧𝐬! 𝐘𝐨𝐮'𝐯𝐞 𝐛𝐞𝐞𝐧 𝐬𝐞𝐥𝐞𝐜𝐭𝐞𝐝 𝐭𝐨 𝐚𝐭𝐭𝐞𝐧𝐝 𝐕𝐞𝐫𝐢𝐝𝐚𝐧 𝐇𝐢𝐥𝐥 𝐀𝐜𝐚𝐝𝐞𝐦𝐲! ───── ⋆⋅☆⋅⋆ ───── Founded by visionaries Ernest H. Bailey and Norman P. Mizona in Spokane, Washington, Verdian Hill Academy is a prestigious boarding school for the minds of the brightest scholars. Verdian Hill Academy is a present day, semi-lit, dark academia themed high school role play where your OC will study at the best school in America, make the bestest of friends, find lovers, and be involved in crazy amounts of drama. Our server offers… ↦ Social media channels for your OCs to text and post whatever they are feeling. ↦ Tons of channels for every type of roleplays. ↦ Slots for teacher and student OCs. ↦ Numerous sports and classes for your OC to be apart of. ↦ Intereactive lore and events that will keep things interesting. ↦ SFW and inclusive server for all. 𝐂𝐨𝐦𝐦𝐢𝐭 𝐭𝐨 𝐕𝐞𝐫𝐢𝐝𝐚𝐧 𝐇𝐢𝐥𝐥, 𝐲𝐨𝐮 𝐰𝐨𝐧𝐭 𝐫𝐞𝐠𝐫𝐞𝐭 𝐢𝐭.

Today's activity
21💬
18🟢
1👥
0📞
Server overview
88👥Total members
1📅years old
13+Age requirement
server profile pic
Clan NZ Senkais™
socialcommunitygamingrobloxchatmemesmusicespañolspanishjailbreakbloxfruitmeepcityadopt meamistadgamesjuegojuegosyoutubeamigoamigosanimelatinobattlegroundsgrupogrupo de robloxalianzachillcomunidadtwitchvideojuegosroleplayrpmusicamusicvcgamesfun
Description

SERVIDOR OFICIAL Bienvenidos A Clan NZ Senkais™ ツ ★┆NO HAY REGLAS Espero Les Guste Cracks ;3

Today's activity
17💬
12🟢
2👥
0📞
Server overview
66👥Total members
1📅years old
13+Age requirement
server profile pic
͙͘͡★ 𝑨𝒔𝒕𝒓𝒂𝒍 乂 𝑶𝒅𝒚𝒔𝒔𝒆𝒚.ᐟ
roleplayrpcombat roleplaymultifandomrole-playrole-playingcrpsocial
Description

Gaze into space as you walk a path anew: Astral Odyssey!
The universe conquering goddess invites you to one of her own, she calls this place home. ★

‘Astral Odyssey’ is a server where you can roleplay to your heart’s content! Our aesthetic is mostly themed around space and the cosmos, but if the astro exterior doesn't suit your fancy, we’ve got the slice of life stuff covered, with a few extra things thrown in from different medias.

The lore of the server’s got a lot to it, but that shouldn't be any reason to dismantle your own creativity. Come and add on to this giant story. We love to see it!
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
+。:.゚Dependable & active staff.
+。:.゚Self-assignable roles.
+。:.゚Friendly little community.
+。:.゚SFW content.
+。:.゚Anyone 13+ is totally allowed.
+。:.゚A moderate amount of locations, with suggestions to boot!
+。:.゚Any typing/RP style is completely welcome, no shame.
+。:.゚Server-wide arcs, and with staff permission, you can make one of your own!
+。:.゚Unique ensemble of all things, OCs are no exception.

Come and show some love… ***the universe calls out to you!***

Today's activity
15💬
31🟢
2👥
0📞
Server overview
76👥Total members
3📅years old
13+Age requirement
server profile pic
Bruxos e Magos RPGs
rpgcomunidadememeroleplayarteamigos
Description

Neste servidor estarei criando um sistema próprio com vocês, aonde consiste em um universo de Bruxos e Magos unicamente os dois.

Atualmente o sistema se encontra na versão 0.1, com vários erros de Ortografia e do Sistema, mas tudo começa de algum lugar. Este livro não foi feito para ser vendido ou qualquer coisa do tipo, é de utilidade pública e todos podem vê-lo e usá-lo mas não modifica-los ( por tais razões existem Homebrews ). Atualmente ele já pode ser utilizado pois mesmo havendo vários defeitos, ele funciona.

Espero que com essa comunidade nós conseguiremos criar algo único juntos, melhorando cada vez mais e mais até criar algo de nível profissional. Obrigado a todos que participarem e todos que participarão ☺️

Antes de tudo, me chamo Vitor, sou mestre de RPG a 3 anos, e este é meu primeiro livro. Agradeço novamente a todos que ajudarem e colaborarem para criarmos uma comunidade incrível.

Today's activity
8💬
12🟢
1👥
0📞
Server overview
33👥Total members
2📅years old
13+Age requirement
Description

Violent winds hissed around the borders of Empyrea. Intimidating avians stood guard with shimmering swords and heavy armour.
Suddenly, a voice rung out.
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
𝐍𝐨𝐧-𝐀𝐯𝐢𝐚𝐧 | "Stand on the wall for your picture." You walk over to the wall, the border patrol agent looking you up and down. A snap flashes before you. "Fill this out." You fill out your date of birth, full name, species, and give it back. After a moment, the following is handed to you and the barrier opens.
╔═══ .·:·.⚔︎✧ ✦ ✧𓂋.·:·. ═══╗
ᴇᴍᴘʏʀᴇᴀ ɪᴅ ᴄᴀʀᴅ
Identification NO: 13XXXX
DOB: M/D/Y
Issue Date: M/D/Y
Full Name: Jane Doe
Species: Species
Class: A0 - A4
Sect: -
ꜰᴏᴜɴᴅ? ʀᴇᴘᴏʀᴛ ᴛᴏ ᴇᴍᴘʏʀᴇᴀɴ ʙᴘ ᴏꜰꜰɪᴄᴇ.
╚═══ .·:·.⚔︎✧ ✦ ✧𓂋.·:·. ═══╝
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
𝐀𝐯𝐢𝐚𝐧 | "Identification card please." You hand over your ID card. The Border Patrol Agent glances at it, you, and nods. "Welcome back." The barrier opens.
╔═══ *.·:·.⚔︎✧ ✦ ✧𓂋.·:·.* ═══╗
ᴇᴍᴘʏʀᴇᴀ ɪᴅ ᴄᴀʀᴅ
Identification NO: 01XXXX | 02XXXX
DOB: M/D/Y
Issue Date: M/D/Y
Full Name: Jane Doe
Species: Avian
Class: A0 - A4 | DO -D4
Sect: Warrior | Noble
ꜰᴏᴜɴᴅ? ʀᴇᴘᴏʀᴛ ᴛᴏ ᴇᴍᴘʏʀᴇᴀɴ ʙᴘ ᴏꜰꜰɪᴄᴇ.
╚═══ *.·:·.⚔︎✧ ✦ ✧𓂋.·:·.* ═══╝
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
ʟɪᴋᴇ ᴡʜᴀᴛ ʏᴏᴜ ʀᴇᴀᴅ? ᴍᴏʀᴇ ɪɴꜰᴏʀᴍᴀᴛɪᴏɴ ᴀᴠᴀɪʟᴀʙʟᴇ ᴀᴛ: https://discord.gg/hw8thdvh9D
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
ꜱᴜᴍᴍᴀʀʏ: ʟᴀɴᴅ ᴏꜰ ᴇᴍᴘʏʀᴇᴀ ɪꜱ ᴀ ꜰʀᴇᴇꜰᴏʀᴍ ꜰᴀɴᴛᴀꜱʏ ꜱᴇʀᴠᴇʀ ʜᴏᴍᴇ ᴛᴏ ᴛʜᴇ ᴇᴍᴘʏʀᴇᴀɴꜱ. ᴡᴀʀʀɪᴏʀꜱ ᴀʀᴇ ᴇᴍᴘʏʀᴇᴀ'ꜱ ᴀʀᴍᴏᴜʀ, ᴅᴇꜰᴇɴᴅɪɴɢ ᴛʜᴇɪʀ ᴍᴏᴛʜᴇʀʟᴀɴᴅ ᴡɪᴛʜ ʙʀᴀᴠᴇʀʏ ᴀɴᴅ ʜᴏɴᴏʀ. ɴᴏʙʟᴇꜱ ᴀʀᴇ ᴇᴍᴘʏʀᴇᴀ'ꜱ ʙʟᴏᴏᴅ, ꜱᴜꜱᴛᴀɪɴɪɴɢ ᴛʜᴇɪʀ ᴄᴜʟᴛᴜʀᴇꜱ ꜱᴜʀᴠɪᴠᴀʟ. ᴅᴇᴠᴇʟᴏᴘ ᴡʜᴏ ʏᴏᴜ ʙᴇᴄᴏᴍᴇ ᴛʜʀᴏᴜɢʜ ʀᴏʟᴇᴘʟᴀʏ, ᴍɪꜱꜱɪᴏɴꜱ, ᴀɴᴅ ᴇᴠᴇɴᴛꜱ. ᴇxᴘʟᴏʀᴇ ʏᴏᴜʀ ᴘᴏᴛᴇɴᴛɪᴀʟ ᴛᴏᴅᴀʏ: ᴀᴠɪᴀɴ ᴏʀ ɴᴏɴ-ᴀᴠɪᴀɴ!

Today's activity
7💬
12🟢
1👥
0📞
Server overview
22👥Total members
2📅months old
13+Age requirement
server profile pic
" Hold On " !! Detroit Become Human RP
dbhdetroit become humanroleplaydbh rpcommunitygamehangoutrp
Description

𖦹ㅤ ̼ ₊ㅤㅤLOADING. . . ㅤ ۪ ֹ

Detroit 2038. Technology has evolved to a point where human-like androids are everywhere. They speak, move and behave like human beings, but they are only machines serving humans. Play three distinct androids and see a world at the brink of chaos – perhaps our future - through their eyes

>﹒Main characters. Funny thing to call people. The world doesn't have main characters. They are just people that suffer and those who cause pain.

A free will. Yes, that's what is causing pain and chaos. There's no "choose" option anymore. There are just people and their will.

Think wisely. Nothing happens without a reason . . .

. . .
. . . . . .

> LOADING FINISHED

> PROCESS TO CONTINUE?
> YES > NO


⊹ ⠀࣪⠀ㅤㅤ ㅤ OUR OFFERT. . . ִ
> many free cc
> helpful crew including admins and mods
> chance to write your own storyline
> oc friendly
> safe community
> semi-lit / literate community
↷﹒⇆﹒

Today's activity
3💬
35🟢
2👥
0📞
Server overview
127👥Total members
1📅years old
13+Age requirement
Description

+ ━━━━☆ WELCOME TO THE GREENFIELD ACADEMY! ☆━━━━ +

Embark on a thrilling journey into the extraordinary at Greenfield Academy, where the year is 2044, and a new generation of heroes is rising. Dive into a captivating server where you have the power to shape your own original characters and unfold epic tales of heroism and discovery!

✨ Unleash Your Superhuman Potential ✨

Step into the bustling metropolis of Charter City, home to Greenfield Academy, a prestigious institution for molding future heroes. The students possess unique powers inherited from their grandparents who experienced an event known as "The Black Hole Incident." Explore a world where extraordinary abilities are the norm, and the line between hero and villain blurs.

🦸 Craft Your Heroic Legacy 🦸

Create your very own OC, from their compelling backstory to the depths of their superhuman abilities. Immerse yourself in a universe that celebrates originality, where your character's journey is untethered from existing storylines. Join forces with other members to weave tales of heroism, friendship, and self-discovery.

🚀 Soar Above the Rest 🚀

Here at Greenfield Academy, originality reigns supreme. Engage in a rich lore, explore diverse channels to enhance your OC's story, and immerse yourself in a non-toxic community that values creativity and collaboration. We understand the importance of real life, so join roleplays at your own pace without pressure.

What We Offer

- A unique roleplaying experience within the Greenfield Academy universe.
- Diverse channels for character development (Designs, Theme songs, Headcanons, Etc.).
- A welcoming and non-toxic community.
- Flexibility in roleplay participation, attend when you can.

Join us at Greenfield Academy, where destinies are forged, and the legacy of the next generation of heroes begins. Uncover your superhuman potential and let the adventure unfold!

Join the Journey Today!

Today's activity
3💬
27🟢
3👥
0📞
Server overview
92👥Total members
3📅years old
13+Age requirement
Description

a good roleplay server with a gossip girl based lore!

Today's activity
3💬
48🟢
3👥
0📞
Server overview
312👥Total members
2📅years old
13+Age requirement
Description

# __Welcome to the Kingdom of Valceto__
A fairly small kingdom located in northern europe, close to rome and or modern Italy. This is a text roleplay that takes place in the year 1090!. Fantasy!!

*" As the days go on rumor starts to spread about a corpse being found within the palace grounds. People speculate that it was some freak accident, or perhaps a murder? The answers varied from person to person, though no one knew what to believe. They were just rumors after all, right?

Weeks went by and more people have gone missing. Suspicions begin to rise as to who—or—what is causing these disappearances. However, the king has been very adamant about keeping people's mouths shut. "*

Today's activity
2💬
15🟢
1👥
0📞
Server overview
33👥Total members
1📅years old
13+Age requirement
server profile pic
The Lorin Sector: A 40K RP
000character rproleplaywarhammerwarhammer 40
user profile pic
warmind_d409-01-2024 16:20

.

user profile pic
caliph333309-01-2024 08:18

AAAAAAAAAAAAAAA

user profile pic
caliph333310-12-2023 19:34

Join it NOW

Description

The Lorin Sector is an Imperial Sector in the Eastern Fringes caught between the T’au Empire, Realm of Ultramar, the Exodite Worlds, the Jericho Reach, and the Scourge Stars. This territory represents a rugged frontier of Imperial Space, having been far gone ever since the Cracks within Imperial Authority during the Nova Terra Interregnum. Fairly isolated from the million-strong armies and mighty Battlefleets of the Imperial Heartland, it is a Sector that is ultimately blessed by its positioning, yet must always fend for itself against the threats creeping in. May it be Genestealer Cults, Xenos Races, Warp Spawn and their Mortal Followers, Redemptionists, or even Dark Ancient Forces beyond all of them. This Warhammer Roleplay is generally based around relative freedom to play what you desire. Although we somewhat focus on playing various Warlords of different factions, we generally try and offer options for character campaigns and the like. We have a relative large staff that is friendly and will attempt to help others in need. Feel free to hop in!

Today's activity
2💬
47🟢
2👥
0📞
Server overview
224👥Total members
2📅years old
15+Age requirement
server profile pic
MARVEL’S UNBECOMING
marvelmcuroleplaysemi-literatesuperhero
Description

MARVEL’S UNBECOMING What are heroes? How would you define heroes? It’s a complicated question now as it doesn’t exactly mean what you think it means. Usually you would look towards the avengers as heroes but now? Now you look towards people with a corrupted mindset that instills fear in you. With that being said there is a place that is locked away for mutants wanting to use their powers for good, it’s the Rosetta Academy, built to make heroes amongst other things but they are there to try and fix the world once again. Will it be fixed or will these fraud heroes run our world into the ground? What can the server offer? — Good Moderator team — Canon Parents/Mentors — Slice of life/Character driven plot — Great community — And much more for you to see! — Pluralkit supported! Join to see the rest of the server!

Today's activity
2💬
17🟢
1👥
0📞
Server overview
37👥Total members
2📅years old
13+Age requirement
server profile pic
The Democratic Server of Kaeska
political roleplaypoliticschattingroleplay
Description

The Democratic Server of Kaeska is a place where YOU can take charge. Create or join the political parties of your dreams. Run for President. Create laws. Vote on issues. Win the hearts of your fellow servermates. Created and moderated by an experienced team of people, we feature a custom discord bot, and a thriving community. Will Kaeska be the perfect utopia? Or will you run it into the ground? The choice is YOURS. Welcome to the Democratic Server of Kaeska.

Today's activity
1💬
13🟢
1👥
0📞
Server overview
92👥Total members
1📅years old
13+Age requirement
Description

𝐖𝐄𝐋𝐂𝐎𝐌𝐄 𝐓𝐎 𝐓𝐇𝐄 𝐂𝐔𝐑𝐒𝐄𝐃 𝐑𝐄𝐀𝐋𝐌

𝑵𝒆𝒘 𝑺𝒆𝒓𝒗𝒆𝒓 (𝑫𝒆𝒗𝒆𝒍𝒐𝒑𝒊𝒏𝒈)

𝐶𝑜𝑚𝑚𝑢𝑛𝑖𝑡𝑦
Our server is not only based off of Jujutsu Kaisen or Anime only. We have a comfy and wonderful area for everyone alike. Welcoming all gamers and anyone who would like a community to surround them!

𝑅𝑜𝑙𝑒𝑝𝑙𝑎𝑦
Our roleplays are not strictly based off of Jujutsu Kaisen. It does not have to follow canon 100%, but we do have canon channels for our storylines. You are welcome to roleplay any outside AUs or crazy situations with Crack Roleplay channels! Make sure Roleplay is fair and everyone can play without fights between ideals. (This Includes if someone is uncomfortable in a CRP or Crack Rp)

𝐺𝑎𝑚𝑖𝑛𝑔 𝑎𝑛𝑑 𝑆𝑡𝑟𝑒𝑎𝑚𝑠
We welcome Discord Streamers and Gamers alike! If your an anime junkie, we also have channels for that too! Stream within our designated channels, keep game talk in the gaming channel, and have some fun!!

𝑃𝑟𝑜𝑓𝑎𝑛𝑖𝑡𝑦, 𝑁𝑆𝐹𝑊, 𝑎𝑛𝑑 𝑆𝑙𝑢𝑟𝑠
Profanity is Allowed in our server, aswell as NSFW. SLURS ARE NOT ALLOWED AND WILL RESULT IN A BAN. we allow the use of profanity as it is a common habit of human nature, but slurs are stict prohibited and against our server's peace. NSFW is allowed, but it MUST stay in its DESIGNATED CHANNEL. If you are caught posting NSFW images outside of the NSFW channel, you will be warned. ERP is allowed, but with the use of a thread listed as NSFW Roleplay (characters names) or ERP( Characters names).

1st Offense = Timeout
2nd Offense = Kick
3rd and Final Offense = BANNED

𝐶𝑎𝑛𝑜𝑛 𝑎𝑛𝑑 𝑂𝐶𝑠 𝐴𝑙𝑙𝑜𝑤𝑒𝑑
We offer both your choice of making and using your own OC to fewl comfortable within Roleplay. We also have a wide variety of canons to choose from!

Today's activity
1💬
15🟢
1👥
0📞
Server overview
42👥Total members
1📅years old
16+Age requirement
server profile pic
The New World
combat roleplaycrpmultifandomrole-playroleplayrole-playingsemi-literatesocial
user profile pic
spiderm822-09-2023 20:35

Raw, goat, fire. This server saves my marriage, and now my kids respect me again. 10/10

user profile pic
chronus1323-09-2023 20:47

Peak people

user profile pic
spiderm826-10-2023 18:31

Cream of the crop fr

Description

Launch headfirst into a world filled with endless possibilities! Taking place in a multiversal space, this server allows for you to roleplay as any character of your choosing, be it OC or canon! All types of RP are welcome, especially combat RP, which you might need when facing down in the dangerous depths of The Expanse: A 2nd, more ruthless world that many adventurers have traveled. While the first few regions have been explored, few have gone down to the deepest depths, a seemingly infinite space where no one has returned from…

If you’re not a fan of RP, or simply want a break, there’s many more things you can do in this server, whether it be chatting with other people, playing games in the server, or just chilling out in VC! It’s all up to you, really.

Join in to experience all this and more! And if you do, all we can say is…

Welcome… to The New World!

Today's activity
1💬
14🟢
1👥
0📞
Server overview
27👥Total members
2📅years old
13+Age requirement
server profile pic
KRAKENS REACH - BERMUDAS DEPTHS
socialcommunitychillgaminghangoutwritingeventsrpoccasuallore
Description

The central hub for the beloved Bermudas Depths community, and the house of the Krakenborn. Sip a few beers and praise the Kraken! (This server is application only; the questions are not advanced, they are simply to get you into the right mood for the server.) A developing storyline set in an alternate dimension of the Bermuda Triangle, where demons prey on unsuspecting lost souls... Participate in contests to develop the setting, enjoy reading lore and asking questions about it, play in gamenights, roleplay, or simply exist. We don't mind whichever path you choose.

Today's activity
0💬
14🟢
0👥
0📞
Server overview
21👥Total members
3📅months old
13+Age requirement
server profile pic
FIM: World in Darkness
roleplayrpmlpzombieapolcaypsezombie-rp
user profile pic
somemfwholikeshalo11-01-2026 19:03

FIM: World in Darkness can be considered an AU, It takes place in a version of Equestria where the Elements of Harmony failed to conceal Nightmare Moon and only helped her plunge the world into chaos. It is a literate Roleplay server, and I would love to meet new people who would love to build on a story and create something great! I am currently the only admin on the server, but that could possibly change in the future. I am looking for a group of people, at a minimum, who would like to participate in a story. Tired of the usual MLP Roleplay server? Then give this server a try!

Description

FIM: World in Darkness can be considered an AU, It takes place in a version of Equestria where the Elements of Harmony failed to conceal Nightmare Moon and only helped her plunge the world into chaos. It is a literate Roleplay server, and I would love to meet new people who would love to build on a story and create something great! I am currently the only admin on the server, but that could possibly change in the future. I am looking for a group of people, at a minimum, who would like to participate in a story. Tired of the usual MLP Roleplay server? Then give this server a try!

Today's activity
0💬
5🟢
0👥
0📞
Server overview
6👥Total members
1📅months old
18+Age requirement

210 servers found