Roleplay Discord servers

211 servers found

server profile pic
Pine Creek Summer Camp 🏕
roleplayrpslice of lifesolcommunity
Description

We are an 18+ SFW roleplay server that mainly focuses on slice of life but we encourage our members to be as creative as they wish. Whether you want some adventure, angst, mystery or romance, we can do it all here.

We encourage creativity and enjoy a smattering of chaos from time to time - whether it be kids getting revenge against a mean staff member, escalating prank wars or accidentally burning down the boathouse with a misplaced firework.

The Pine Creek Summer Camp is an inclusive camp for children and teenagers from all walks of life - with special catering for those who are disabled, neurodivergent or in any way impoverished or troubled. With fun indoor and outdoor activities, all are welcome.

We have dozens of indoor and outdoor locations for 1x1 and small group roleplays as well as chatroom style channels you can use to talk as your characters to other characters. We use Tupperbox for added immersion and are happy to help beginners set up their characters and learn how to use it.

What we offer:
▫️ A welcoming, friendly community
▫️ Inclusive to everybody, regardless of race, religion, gender or sexuality
▫️ Dedicated staff who are passionate about roleplaying
▫️ OOC chat channels
▫️ Media, meme, and art channels

Today's activity
1.0k💬
20🟢
13👥
0📞
Server overview
36👥Total members
5📅months old
18+Age requirement
server profile pic
Animation Destination Roleplay
roleplayDisneyDreamWorksilluminationNickelodeon
Description

Hi! I'm looking for mature people or people 18 years of age and older that love animation to join a Discord roleplay. Roleplay in any style you want. You can choose animated characters from Disney, DreamWorks, Illumination, Nickelodeon, and more. Hope to see you there!

Today's activity
49💬
8🟢
4👥
0📞
Server overview
42👥Total members
10📅months old
18+Age requirement
server profile pic
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
1.7k💬
650🟢
89👥
41📞
Server overview
5.5k👥Total members
5📅years old
13+Age requirement
server profile pic
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
2.6k💬
27🟢
22👥
5📞
Server overview
117👥Total members
2📅years old
14+Age requirement
server profile pic
The Writer's Library {{21+}}
friendlysocialroleplayrpcommunitywritingroleplayerroleplay partnerwritersactive
Description

Welcome to the Writers Library. All writing levels are welcome! We are a 21+ Role Play server. We do request your work be human written. Here you can find yourself lost in the pages of your own creations and meet other writers to join you.

Today's activity
2.4k💬
91🟢
56👥
11📞
Server overview
312👥Total members
4📅months old
21+Age requirement
server profile pic
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
2.4k💬
52🟢
25👥
0📞
Server overview
234👥Total members
2📅years old
13+Age requirement
server profile pic
Bakugan: Infinite Dimensions
bakuganbakugan battle brawlerspokemonroleplayyugioh
Description

Welcome to the world of Bakugan! This server is the perfect hangout spot for Bakugan fans and collectors all over the world. We have an optional roleplay that welcomes the use of OCs that takes place in an alternate timeline from the legacy anime series. You can expect: A helpful, supportive and inclusive group of people, Active members, Kind moderators who dont abuse power, Space to share your collections and memories, Opportunity to meet new people and make lasting friendships, Several bots to play with, and an optional semi-literate rp experience with a unique story and antagonist, the ability to create your own OCs, cards and bakugan, with fair and balanced game rules with a level up system based on the video game!

Today's activity
9💬
102🟢
8👥
0📞
Server overview
439👥Total members
3📅years old
13+Age requirement
server profile pic
𝗗𝟰
communitysocialchillroleplaygaminggameshangoutanimefriendsfunfriendlyartchatmusicvcsfwactiveminecraftrobloxmoviesmemesmangafortniteeventsrpcreativevalorantvoicenon-toxicprogrammingdiscordcatssportsfootballservernontoxicanimalsfriendgtaself-promopartnershipsmusiciansmusicianweedmusic producerscontent creatormaking-friendsboyssoccersmokerskategirlsskateboardhang outsmoking420hangoutsfemalecars24/7waxmarijuanafriendly staffskaterswomenskateboardinganti-pedomenpoemshangout-serverfemalesvapingd4partnershipconcentratesamonguscannabisogdankdabthc-concentratessmokeskate-or-diemalevapessk8stonervaporskatersnowboardingdiscord-serverequalitydabsvoicechatvoice chatvoice-chat
Description

A server designed to fit the interests of every member that joins, while being a safe community.

● 𝐀 𝐂𝐎𝐌𝐌𝐔𝐍𝐈𝐓𝐘 𝐌𝐀𝐃𝐄 𝐅𝐎𝐑
┃ WEEBS
┃ GAMERS
┃ STONERS
┃ SKATERS
┃ ARTISTS
┃ HIPPIES
┃ EQUALITY
┃ ATHLETES
┃ MUSICIANS
┃ PROGRAMMERS
┃ MOVIE NIGHTS
┃ CONTENT CREATORS
┃ FREEDOM OF EXPRESSION
● DAILY JOINS MAKING THIS A GREAT SERVER FOR MEETING NEW PEOPLE EVERYDAY

Today's activity
1.5k💬
144🟢
56👥
27📞
Server overview
565👥Total members
7📅months old
13+Age requirement
server profile pic
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
1.4k💬
76🟢
30👥
5📞
Server overview
1.2k👥Total members
3📅years old
13+Age requirement
server profile pic
Tales of Ideals
roleplaysuperherosuperheroes
user profile pic
the_sigg02-09-2024 13:23

Testing!

user profile pic
the_sigg02-09-2024 13:24

Hey there, get in!

Description

***For as long as humans have dreamed, we have dreamed of heroes.*** ***What if these dreams could come true? Could the world handle such power?*** ***These are...*** # _ _ _ _ 『 𝕋𝕒𝕝𝕖𝕤 𝕠𝕗 𝕀𝕕𝕖𝕒𝕝𝕤 』 _ _ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ Set in an alternate history version of our world, __**Tales of Ideals**__ tells the story of a world where superheroes have gone all but extinct. Following the destruction of much of civilization, society has lost faith in its protectors. In the United States, those that remain are under the watch of the **Superhuman Public Response** team. Now, in the year 2024, the balance of the world is in the hands of a new age of superheroes. Stagnant for decades, it is finally time for them to rise up again... but will they succeed? Will crime and villainy prevail at last? Or will this age die out before it gets going, and force the world to recover without supers? ### *The future is up to you!* _ _ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ## 𝓕𝓔𝓐𝓣𝓤𝓡𝓘𝓝𝓖: 💥 A world with decades of alternate history to discover! 🌎 Over **60** channels to roleplay in! 👊 The ability to create your own superheroes (or villains!) 🔥 A narrative focused approach, with an evolving world! ⚡ A class- & archetype-based system of character growth!

Today's activity
85💬
23🟢
6👥
0📞
Server overview
46👥Total members
1📅years old
18+Age requirement
server profile pic
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
1.1k💬
92🟢
36👥
4📞
Server overview
368👥Total members
3📅years old
16+Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
4.9k💬
122🟢
43👥
9📞
Server overview
660👥Total members
6📅years old
14+Age requirement
Description

a good roleplay server with a gossip girl based lore!

Today's activity
487💬
38🟢
15👥
0📞
Server overview
302👥Total members
2📅years old
13+Age requirement
server profile pic
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
560💬
1.5k🟢
40👥
5📞
Server overview
12.3k👥Total members
8📅years old
13+Age requirement
server profile pic
Disney RP: Land of Wonder
roleplaydisneydisney rpmarvelmarvel rppixarmcumcu rpkingdom hearts
Description

A new Disney-centric RP server bringing together Disney, Kingdom Hearts, Marvel, Pixar and Star Wars for adventures like no other!

- A fun crossover setting mixing together some of the world's most favorite universes for fun and adventure

- A comfortabile and relaxed roleplay server with a unique setting and a welcoming and warm abode for all fans alike

- Tons of canons free for the taking with tons of opportunities to expand and develop their characters beyond their normal settings as well as opportunities to craft your own OCs

- A lax writing server that isn't strict. We just want you to come here and have fun writing up your fantastical stories.

**A world of magic is unlocked. A universe of light and darkness but in the center of this chaotic maelstrom is tbe infinite possibilities for new adventures and friendships!**

https://tenor.com/view/walt-disney-pictures-intro-gif-15386421

https://discord.gg/6HhQPhRtnx

Today's activity
8💬
24🟢
3👥
0📞
Server overview
68👥Total members
3📅years old
15+Age requirement
server profile pic
RP n’ Chill
role-playroleplay
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
412💬
129🟢
25👥
0📞
Server overview
1.1k👥Total members
5📅years old
15+Age requirement
server profile pic
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
1.1k💬
36🟢
20👥
2📞
Server overview
111👥Total members
1📅years old
16+Age requirement
server profile pic
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
228💬
48🟢
15👥
0📞
Server overview
152👥Total members
4📅years old
15+Age requirement
server profile pic
|| JJK || The Jujutsu Experience
jjkjjk roleplayjjk rpjujutsu kaisenjujutsu kaisen roleplayjujutsu kaisen rproleplay
user profile pic
gumeybear2122-09-2024 13:04

a

Description

The Jujutsu Experience! It's a roleplaying/hangout JJK server!! Your oc's make the future! It's simple and an up n' coming server. - Cannon Techniques to be claimed by YOUR ocs ;o - Friendly staff (I think I'm friendly anyways) - Easy to understand templates - Sukuna's vessel up for grabs >:)) So why don't you come on down and join! Even if you just want to hangout and chat, that's what we're here for, but if you want to rp, come make an oc that'll shape the lore of the server!

Today's activity
318💬
106🟢
41👥
3📞
Server overview
329👥Total members
1📅years old
13+Age requirement
server profile pic
Taisho High: The First Aces!
fantasyhighschoolmagicocroleplaysci-fi
Description

WELCOME TO THE GRAND REOPENING OF TAISHO HIGH!

Whether you're a visitor looking in, or returning member, we welcome you with open arms! We're an exciting high school based RP server, which takes place further inti the future!

✨Rise through the ranks and discover your true power! ✨

At taisho high, you can expect:

* An easy to understand class system

* Wide range of freedom for OC'S

* Several opportunities for deep character development

* Engaging events, with valuable server rewards

* Helpful staff

* Progression of power

And much more!

Will you become a true Ace?

Today's activity
8💬
27🟢
3👥
0📞
Server overview
63👥Total members
2📅years old
13+Age requirement
server profile pic
city in the sky · fluffy tag
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
11.0k💬
390🟢
115👥
2📞
Server overview
2.8k👥Total members
1📅years old
13+Age requirement
server profile pic
the Eternity
horrorroleplaywriting
Description

a new, somewhat horror based rp server set in a luxury hotel. Ocs and canon characters are allowed. We're just starting off, so join now!

Today's activity
25💬
8🟢
3👥
0📞
Server overview
17👥Total members
2📅years old
16+Age requirement
server profile pic
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥
dungeons and dragonsd&dttrpghobbiesdndtabletoproleplay
Description

The City of Brass is a place for people to share and discuss their hobbies, favorite media, and worldbuilding projects; whether it be for a tabletop game like Dungeons and Dragons, or just for the fun of it! We also like to make and give/receive feedback on Hombrew content for D&D!

Today's activity
50💬
29🟢
5👥
0📞
Server overview
81👥Total members
4📅years old
18+Age requirement
server profile pic
/saucee | ask2dm • egirl • dating • social • active
socialcommunitychillroleplaygamesanimefriendsactivemoviesegirlfreakyactive-voicechatdatingedating
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
18.1k💬
101🟢
247👥
12📞
Server overview
1.1k👥Total members
1📅years old
13+Age requirement
server profile pic
Avalon Community Servers
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
37💬
86🟢
14👥
0📞
Server overview
1.0k👥Total members
8📅years old
13+Age requirement
server profile pic
Rus' | Into The Frost
adventurefantasymedievalroleplay
Description

With a long winter preparing to encapsulate the Tsardom of Rus' and all living things within the Russkaya Zemlya, we invite you to join us in the new and improved Rus' Universe. Dobro pozhalovat' v Rus! Welcome to the Rus', my friend. The "Rus' | Into The Frost" is a server based on 15th-Century Medieval Russia with a fantasy twist. Imagine a world where legendary creatures found in traditional folklore coexisted alongside ManKind. It is in our universe that adventurers from all corners of the globe travel to the Land of the Rus' to test their mettle against the ferocious beasts that dominate the cold lands. Limited by only your own brilliant creativity, you are allowed to start off as a majestic and nimble Kitsune from the Far East—using magic to turn your foes to dust. You can even try to slay beasts as an Elven Archer from the Germanic Region who can strike down their prey from miles away, a werewolf, vampire, orc, and so much more. Don't be afraid to strive for whatever your artistic mind desires. This is a community that accepts all passionate to write, role-play, and help build an immersive universe influenced by its members and everything we do as a community. Upon joining, we ask that you take the time to read the instructions provided in our welcome channel. We are a very well-written and fleshed-out server. We hope that you'll be joining us very soon on our courageous adventures, friend.

Today's activity
221💬
23🟢
9👥
0📞
Server overview
42👥Total members
3📅years old
18+Age requirement
server profile pic
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
134💬
67🟢
14👥
0📞
Server overview
201👥Total members
3📅years old
13+Age requirement
server profile pic
Dragon Ball Finality
communityroleplayvoicedbzdbdragon ball
Description

🌌 DRAGON BALL FINALITY 🌌
An 18+ literate, stat-based roleplay server

📜 The Setting
Age 430 — the Earth is raw and untamed.
No capsules, no space travel — only scattered kingdoms, hidden dojos, and wandering martial artists. Ki is rare, magic is feared, and demons stalk the shadows. Every punch, every beam, every choice shapes history.

⚔️ Plot System
» A-Plots – Admin-led, canon, world-shaking.
» B-Plots – Player + admin collab, canon, medium scale.
» C-Plots – Player-run, flexible, fun, sometimes canon.

✨ Features
» Unique stat-based combat system (Ki • Effort • Magic).
» Automation bots keep fights fast & fair.
» OC-driven stories – forge your own legend.
» 18+ only, zero-tolerance for harassment.

👊 Will you fight for glory, survival, or something greater?
The World is waiting.

Today's activity
11💬
18🟢
3👥
0📞
Server overview
40👥Total members
6📅months old
18+Age requirement
server profile pic
Mirabilis: Fantasy RP
dndhomebrewroleplayfantasysfw
Description

"Your hopes and prayers are now useless. You cannot handle the power Lucifer is going to produce onto Mirabilis. We shall now reign hell and have everyone suffer damnation." - Count Xorgoth of the Underworld

Welcome to the Age of Damnation! It may seem like paradise, but... it's not what your eyes would seem...

Hey, nerd! Are you tired of fantasy roleplay number 500,728? Do you like nation roleplaying? What about Dunegon's & Dragons? If you said yes to ANY of these questions, Mirabilis is right for you! Here we host campaigns, discuss about OCs, have fun, chill and hangout, and most of all let our imaginations wander! Just in the palm of your hands.

What are we looking for?: Gamemasters, mappers, active members, you, staff, partners, and roleplayers.

Here's what we have to offer!

🥰 - A safe haven for everyone! Especially artists, the LGBTQIA+, furries, new roleplayers, and novella ones too!

🦊 - Many races to choose from! Humans? maybe fursona species? Something you probably don't know? We have it! And there's more to come!

⚔️ - Stuff such as arena mode, prophecies, events, and many things to keep you entertained!

👍 - SFW! Yes, your 13 year old brother could view this too!

🤔 - Tools to help you create something you want to submit! If you had a lightbulb, it would be shining after you get help.

😱 - An active and growing community! Care enough to contribute?

👾 - Campaigns hosted occasionally! Find some campaigns you want to focus on playing in!

Your journey to a good roleplay is a click/tap away! Give it a try! And I promise you won't regret it.

Today's activity
10💬
31🟢
3👥
0📞
Server overview
117👥Total members
1📅years old
13+Age requirement
server profile pic
FIM: World in Darkness
roleplayrpmlpzombieapolcaypsezombie-rp
user profile pic
somemfwholikeshalo11-01-2026 19:03

FIM: World in Darkness can be considered an AU, It takes place in a version of Equestria where the Elements of Harmony failed to conceal Nightmare Moon and only helped her plunge the world into chaos. It is a literate Roleplay server, and I would love to meet new people who would love to build on a story and create something great! I am currently the only admin on the server, but that could possibly change in the future. I am looking for a group of people, at a minimum, who would like to participate in a story. Tired of the usual MLP Roleplay server? Then give this server a try!

Description

FIM: World in Darkness can be considered an AU, It takes place in a version of Equestria where the Elements of Harmony failed to conceal Nightmare Moon and only helped her plunge the world into chaos. It is a literate Roleplay server, and I would love to meet new people who would love to build on a story and create something great! I am currently the only admin on the server, but that could possibly change in the future. I am looking for a group of people, at a minimum, who would like to participate in a story. Tired of the usual MLP Roleplay server? Then give this server a try!

Today's activity
13💬
7🟢
5👥
0📞
Server overview
7👥Total members
10📅days old
18+Age requirement
server profile pic
Fluid Client
communitysocialactivechillroleplaygaminghangoutgamescreativefriendsfunfriendlyartchatmusicvcsfwrobloxminecraft
Description

Ready to take your Minecraft adventures to the next level? Fluid Client, the unrivaled Minecraft client for 1.8.9, is your ticket to endless possibilities! 🌍 Unleash your imagination, conquer challenges, and build your way to victory! Download now at https://fluidclient.ovh/download.

Today's activity
112💬
513🟢
70👥
1📞
Server overview
9.9k👥Total members
2📅years old
13+Age requirement
Description

ꕤ˖⸝⸝₊˚ Heiwa: 𝐆𝐨𝐥𝐝𝐞𝐧 𝐅𝐚𝐭𝐞 — a Medieval Fantasy Roleplay Server Long ago, the Epoch Shift shattered history; revealing a hidden orange-glowing moon, Nimiel, and changing the world as we know it. Civilizations now rise from the ruins, rediscovering old gods, lost kingdoms, and mysterious crystals embedded deep within the land. Ecosystems evolving far faster than we can keep up with, people redefining themselves and their lives. In this world, magic is a muscle, not an infinite force. Each spell strains the body. Power comes from training, endurance, and discipline. Your story begins here - when anything and everything you do can change the course of the story, how will you choose to live? 𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃 Heiwa is currently in a TRIAL PHASE. From now until NEW YEARS, the server is open for character-making and roleplaying, but no important lore events will occur. If you want to get in to make a mark before we truly kick off, now is the time! Deep, original lore (two moons, a shattered epoch, divine politics, unique magic system) Friendly, active community OC-focused, literate & semi-literate roleplay Medieval fantasy aesthetic Multiple regions, factions, and cultural paths Helpful staff, open channels for new players Event-driven storytelling + player-driven plots Safe, welcoming environment for all Ready to step into the new era? Join the world shaped by Mōna and awakened by Nimiel. Your story awaits.

Today's activity
1.3k💬
47🟢
32👥
19📞
Server overview
83👥Total members
1📅months old
13+Age requirement
server profile pic
Attack On Titan: New Horizons
animeaotattack on titandiscord roleplaydiscord-roleplaydrproleplay
Description

Hello! Welcome to the Attack On Titan: New Horizons Discord Server! We are a roleplay server that focuses mainly on the anime "Attack On Titan", we focus on bringing you the best AOT Roleplay experience possible to you. We allow any type of roleplayers, be it literate, semi-literate or non literate. We just want to give you the best roleplay experience for an Attack On Titan roleplay. (PTK Is off, RTK is on in this server by the way.) Give us any suggestions you may have! Also canon characters not allowed, entirely OC-Driven.

Today's activity
397💬
11🟢
2👥
0📞
Server overview
41👥Total members
2📅years old
13+Age requirement
server profile pic
University of Monsters and Royals
roleplayprincessmonstermonster highdisney
Description

Welcome to The University of Monsters and Royals 𝐖𝐞𝐥𝐜𝐨𝐦𝐞 𝐒𝐭𝐮𝐝𝐞𝐧𝐭𝐬 𝐭𝐨 𝐓𝐡𝐞 𝐔𝐧𝐢𝐯𝐞𝐫𝐬𝐢𝐭𝐲 𝐨𝐟 𝐌𝐨𝐧𝐬𝐭𝐞𝐫𝐬 𝐚𝐧𝐝 𝐑𝐨𝐲𝐚𝐥𝐬! 𝐖𝐞'𝐫𝐞 𝐞𝐱𝐜𝐢𝐭𝐞𝐝 𝐭𝐨 𝐡𝐚𝐯𝐞 𝐲𝐨𝐮 𝐡𝐞𝐫𝐞! 𝐅𝐞𝐞𝐥 𝐟𝐫𝐞𝐞 𝐭𝐨 𝐢𝐧𝐭𝐫𝐨𝐝𝐮𝐜𝐞 𝐲𝐨𝐮𝐫𝐬𝐞𝐥𝐟 𝐚𝐧𝐝 𝐭𝐨𝐮𝐫 𝐚𝐫𝐨𝐮𝐧𝐝 𝐨𝐮𝐫 𝐬𝐜𝐡𝐨𝐨𝐥. 𝐓𝐡𝐢𝐬 𝐢𝐬 𝐚 𝐬𝐚𝐟𝐞 𝐬𝐩𝐚𝐜𝐞 𝐟𝐨𝐫 𝐚𝐥𝐥 𝐏𝐫𝐢𝐧𝐜𝐞𝐬𝐬 𝐚𝐧𝐝 𝐒𝐮𝐩𝐞𝐫𝐧𝐚𝐭𝐮𝐫𝐚𝐥 𝐥𝐨𝐯𝐢𝐧𝐠 𝐛𝐞𝐢𝐧𝐠𝐬! 𝐎𝐮𝐫 𝐒𝐜𝐡𝐨𝐨𝐥 𝐰𝐢𝐥𝐥 𝐩𝐫𝐨𝐯𝐢𝐝𝐞 𝐨𝐧𝐥𝐲 𝐭𝐡𝐞 𝐛𝐞𝐬𝐭 𝐜𝐚𝐫𝐞 𝐟𝐨𝐫 𝐨𝐮𝐫 𝐬𝐭𝐮𝐝𝐞𝐧𝐭𝐬 𝐚𝐧𝐝 𝐚 𝐩𝐨𝐫𝐭𝐚𝐥 𝐭𝐨 𝐚𝐥𝐥 𝐛𝐞𝐢𝐧𝐠𝐬 𝐨𝐟 𝐚𝐧𝐲 𝐤𝐢𝐧𝐝! 𝐖𝐞 𝐰𝐢𝐥𝐥 𝐛𝐞 𝐝𝐞𝐥𝐢𝐠𝐡𝐭𝐞𝐝 𝐭𝐨 𝐬𝐞𝐞 𝐲𝐨𝐮 𝐭𝐡𝐞𝐫𝐞! 𝐅𝐫𝐨𝐦 𝐲𝐨𝐮𝐫 𝐇𝐞𝐚𝐝 𝐏𝐫𝐢𝐧𝐜𝐢𝐩𝐚𝐥 𝐨𝐟 𝐌𝐨𝐧𝐬𝐭𝐞𝐫𝐬 𝐎𝐩𝐡𝐞𝐥𝐢𝐚 𝐇𝐚𝐧𝐥𝐨𝐧 , What our Server is offering: ★ We are offering canon character slots and multiple OCs slots... that's at a price. ★ We are providing a safe space for you to rant about a ship or character you like, absolutely no judgment. ★ We are also providing you a place to meet new people, new friends that you can take on an adventure. ★ Hehehe and don't forget the awesome Roleplay that's about happen , 𝑴𝒚 𝑴𝒐𝒅 𝒕𝒆𝒂𝒎 𝒂𝒏𝒅 𝑰 𝒂𝒓𝒆 𝒎𝒐𝒓𝒆 𝒕𝒉𝒆𝒏 𝒉𝒂𝒑𝒑𝒚 𝒕𝒐 𝒊𝒏𝒗𝒊𝒕𝒆 𝒚𝒐𝒖 𝒉𝒆𝒓𝒆 .

Today's activity
163💬
18🟢
1👥
0📞
Server overview
34👥Total members
1📅years old
13+Age requirement
server profile pic
Void's End|R2E Alpha
communitydark soulselden ringroleplayworld of warcraftwow
Description

Void's End is a roleplaying server with its own system inspired by world of warcraft, dark souls, and some other things. We accept suggestions to add more, come join us today!

Today's activity
70💬
7🟢
1👥
0📞
Server overview
22👥Total members
1📅years old
13+Age requirement
server profile pic
The MegaCountry SMP - LAUNCH ????
gamesminecraftminecraft smpminecraft-java-editionrp minecraft gamingroleplaymoddedmodsgamingcommunityfunsfwpoliticsnontoxic
user profile pic
youthd4814-12-2024 08:26

This server is awesome!

Description

📜 🌎 Welcome to the MegaCountry SMP, a new modded Minecraft SMP with 30+ players that will start operations soon! We are a modded Minecraft PolSim SMP with many ways to run things! Work your way up the ranks from resident to president, and forge alliances with other players across the multiple city-states! As more players join the SMP, the city-states available to join and lead will increase! Will you lead your city-state to prosperity? Or will your city-state fall to ruin? Our server is nontoxic and strictly adheres to Discord's Community Guidelines. Join us! Your story is what you make of it, and it'll be awesome!

Today's activity
51💬
21🟢
2👥
0📞
Server overview
78👥Total members
1📅years old
13+Age requirement
Description

A pretty chill Kirby Roleplay server. Just follow the rules and you’ll have fun. We’re currently a small server and we hope to see you join

Today's activity
10💬
33🟢
2👥
0📞
Server overview
99👥Total members
8📅months old
13+Age requirement
server profile pic
Bleach: Phantom Conflict the sequel
animeanime roleplayanime rpbleachbleach roleplaybleach rpcommunityroleplay
Description

**. . . . . ╰──╮Bleach: Fall of The Soul Society╭──╯ . . . . .**

In this world, everything in this realm relies on balance. Everything has a process and everything has a flow. In the same way which life has a process, so does death. When a life ends, there is far more to explore. As a matter of fact, one may have access to more in death than they once had in life

A soul can take a variety of paths. A soul may fall with order and a desire to keep peace. One may fall with justice and a wish to destroy the unjust. While others may be fueled with an unimaginable, all consuming darkness.

Welcome to *Bleach: Fall of The Soul Society*! Glad you've decided to take a look at our server. We're happy to introduce you to our

˚₊· ͟͟͞➳❥ Entertaining community

˚₊· ͟͟͞➳❥ Efficient admin team

˚₊· ͟͟͞➳❥ Frequent discussions and conversational topics

˚₊· ͟͟͞➳❥ Variety of different roleplayers with different goals

˚₊· ͟͟͞➳❥ No shortage of roleplay options or locations

˚₊· ͟͟͞➳❥ Simple but effective ranking system for better combat

We hope to see you here. Enjoy yourself!

Today's activity
4💬
14🟢
1👥
0📞
Server overview
50👥Total members
2📅years old
16+Age requirement
server profile pic
JJK: Cursed Surge 18+
roleplayactiverpanime18+friendlywritingliteratejjkjujutsu kaison
Description

In 2018 there was a surge of cursed energy, causing the number of curses and sorcerers to increase. With these new changes the Tokyo and Kyoto Jujutsu Colleges began accepting more sorcerers to be trained at the schools, finding and recruiting people who had cursed energy. New curses began to appear and cause issues- attacking from inside technology. It's 2021, and it seems that a new group of curse users has appeared, their motives are unknown but with each attack they grow closer to the schools. There is word that Geto may be planning to make his reappearance as well. ⁠⁠ ⁺    .    ✦    . ⿴﹒   𓏵ᵎ welc , to cursed surge! ⁺ 𓏵   ┈ come join us, we have got ﹒   𓏵 18+ space! ˙   ⧉  ﹒ ⤷ lots of open characters ﹒   𓏵 oc friendly   ⁺ ˙   ⧉  ﹒ ⤷ interesting lore ﹒   𓏵 welcoming space!   ⁺ ⁺    .    ✦    .

Today's activity
3💬
15🟢
1👥
0📞
Server overview
28👥Total members
11📅months old
18+Age requirement
Description

***TOKYO GHOUL - TRIBUTES***

*This server is 16+!*
It is modern day Tokyo. Years have passed since the Dragon War. Faux allyships between Ghoul and Mankind have crumbled like castles under poor leadership and glorified silver linings. From the ashes rose tired, angry, and vengeful ghouls that were given fragile promises and hope at living a normal life.

The United Front and newly-instated CCG, lead by Matsuri Washuu, are now at war. The CCG believes that it is their rightful title as Japan's proper justice division and that all ghouls must be executed as a means to prevent a third-wave’s occurrence as well as another Dragon Incident. The wards have been distorted in chaos underneath the surface, as constant warring over Tokyo's wards appears to be never-ending.

The strange world just got stranger. The dead are mysteriously rising, old organizations are returning with new faces and new leadership, and the ghoul and human worlds as we know it are headed for significant changes.

Here there is a very lax ranking system, meaning that, until the free-spots are filled for higher ranking ghouls / investigators you may have to have your character be higher ranked. For those that miss out, do not fret. We are solely-activity based, meaning the longer / more active you are the higher the rank you can become via the Arcane bot level system **in roleplay channels only**. Both canons and original characters are welcome. Create your own paths - your lore is incorporated into the server's lore. Have fun and enjoy your stay!

*What we offer*

- Unlimited OCs
- A complete, unique server with all 24 wards and location channels within them
- Semi-lit - Adv. Lit RP
- A small but growing community of friendly, creative people
- Canon Character roles
- Gartic, music bots and streaming voice chats

Today's activity
3💬
7🟢
3👥
0📞
Server overview
33👥Total members
2📅years old
16+Age requirement
server profile pic
KRAKENS REACH - BERMUDAS DEPTHS
rpwritinglorecommunitycasualgamingsocialchillhangouteventsoc
Description

The central hub for the beloved Bermudas Depths community, and the house of the Krakenborn. Sip a few beers and praise the Kraken! (This server is application only; the questions are not advanced, they are simply to get you into the right mood for the server.) A developing storyline set in an alternate dimension of the Bermuda Triangle, where demons prey on unsuspecting lost souls... Participate in contests to develop the setting, enjoy reading lore and asking questions about it, play in gamenights, roleplay, or simply exist. We don't mind whichever path you choose.

Today's activity
2💬
13🟢
2👥
0📞
Server overview
22👥Total members
1📅months old
40+Age requirement
server profile pic
The Democratic Server of Kaeska
political roleplaypoliticschattingroleplay
Description

The Democratic Server of Kaeska is a place where YOU can take charge. Create or join the political parties of your dreams. Run for President. Create laws. Vote on issues. Win the hearts of your fellow servermates. Created and moderated by an experienced team of people, we feature a custom discord bot, and a thriving community. Will Kaeska be the perfect utopia? Or will you run it into the ground? The choice is YOURS. Welcome to the Democratic Server of Kaeska.

Today's activity
2💬
21🟢
1👥
0📞
Server overview
99👥Total members
1📅years old
13+Age requirement
Description

+ ━━━━☆ WELCOME TO THE GREENFIELD ACADEMY! ☆━━━━ +

Embark on a thrilling journey into the extraordinary at Greenfield Academy, where the year is 2044, and a new generation of heroes is rising. Dive into a captivating server where you have the power to shape your own original characters and unfold epic tales of heroism and discovery!

✨ Unleash Your Superhuman Potential ✨

Step into the bustling metropolis of Charter City, home to Greenfield Academy, a prestigious institution for molding future heroes. The students possess unique powers inherited from their grandparents who experienced an event known as "The Black Hole Incident." Explore a world where extraordinary abilities are the norm, and the line between hero and villain blurs.

🦸 Craft Your Heroic Legacy 🦸

Create your very own OC, from their compelling backstory to the depths of their superhuman abilities. Immerse yourself in a universe that celebrates originality, where your character's journey is untethered from existing storylines. Join forces with other members to weave tales of heroism, friendship, and self-discovery.

🚀 Soar Above the Rest 🚀

Here at Greenfield Academy, originality reigns supreme. Engage in a rich lore, explore diverse channels to enhance your OC's story, and immerse yourself in a non-toxic community that values creativity and collaboration. We understand the importance of real life, so join roleplays at your own pace without pressure.

What We Offer

- A unique roleplaying experience within the Greenfield Academy universe.
- Diverse channels for character development (Designs, Theme songs, Headcanons, Etc.).
- A welcoming and non-toxic community.
- Flexibility in roleplay participation, attend when you can.

Join us at Greenfield Academy, where destinies are forged, and the legacy of the next generation of heroes begins. Uncover your superhuman potential and let the adventure unfold!

Join the Journey Today!

Today's activity
2💬
32🟢
1👥
0📞
Server overview
94👥Total members
3📅years old
13+Age requirement
server profile pic
⿻ ; palace of satoru
jjkjujutsu kaisen roleplayroleplayjujutsu kaisenjjk rp
Description

palace of satoru is a semi-lit to novella rp server with only canon characters allowed. we have a stat system and gamemasters. we are looking for staff and gamemasters because we are very new.

Today's activity
2💬
10🟢
1👥
0📞
Server overview
13👥Total members
1📅years old
13+Age requirement
server profile pic
ADURO HUB
robloxroleplayfurrylgbt
Description

🌟💜 Welcome to Aduro Hub! 💜🌟 A warm, vibrant space where LGBTQ+ friends, Roblox adventurers, furries, and anime fans connect, chill, and thrive together! 🐱🎲 Make yourself at home! ^w^ PrismPals is an inclusive, welcoming community where everyone fits right in. ✨ What you’ll discover: 🎲 Roblox game nights & goofy hangouts 🍡 Anime convos, waifu debates & cozy watch parties 🏳️‍🌈 LGBTQ+ affirming, identity-safe haven 🐾 Furry-friendly fun with OCs, art & fursona showcases 💫 Supportive staff & kindhearted members 🎁 Custom roles, fun bots & exciting giveaways 📷 Selfies, memes, edits & all-around silliness 💖✨ In Aduro Hub, your safety is our biggest priority. Every member is treated with kindness, respect, and huge care—because everyone deserves a space where they can relax, be themselves, and feel protected. 🌸🧸 We work hard to keep our community safe, supportive, and full of love. 🌈💕

Today's activity
1💬
7🟢
1👥
0📞
Server overview
11👥Total members
4📅months old
13+Age requirement
server profile pic
" Hold On " !! Detroit Become Human RP
dbhdetroit become humanroleplaydbh rpcommunitygamehangoutrp
Description

𖦹ㅤ ̼ ₊ㅤㅤLOADING. . . ㅤ ۪ ֹ

Detroit 2038. Technology has evolved to a point where human-like androids are everywhere. They speak, move and behave like human beings, but they are only machines serving humans. Play three distinct androids and see a world at the brink of chaos – perhaps our future - through their eyes

>﹒Main characters. Funny thing to call people. The world doesn't have main characters. They are just people that suffer and those who cause pain.

A free will. Yes, that's what is causing pain and chaos. There's no "choose" option anymore. There are just people and their will.

Think wisely. Nothing happens without a reason . . .

. . .
. . . . . .

> LOADING FINISHED

> PROCESS TO CONTINUE?
> YES > NO


⊹ ⠀࣪⠀ㅤㅤ ㅤ OUR OFFERT. . . ִ
> many free cc
> helpful crew including admins and mods
> chance to write your own storyline
> oc friendly
> safe community
> semi-lit / literate community
↷﹒⇆﹒

Today's activity
1💬
28🟢
1👥
0📞
Server overview
122👥Total members
1📅years old
13+Age requirement
server profile pic
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★
roleplaysocialcommunitychillanimehangoutcreativemangaliterateocbleachbleach rpbleach roleplayanime rpanime roleplaymanga rp
user profile pic
coolin.real15-11-2024 18:14

hi guys!

Description

[**``黒— ★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★``**] ***Join our server for an interesting run, an adventure throughout multiple different worlds and realms, a deeper perspective on several different races and untold stories in this entirely new world. You may fight strong opponents, take on new heights, push yourself beyond your limits and even face off against those above! With or without a purpose, be a an active participant in the lore of our server that revolves entirely on you all. Destroy the strongest hollows or even reapers, quincies, fullbringers, humans (hell anything you name it) this era has ever known or just simply do your own thing; Awaken a bankai, shoot arrows, become an espada or develop a mask! The opportunities are practically endless in this Mugetsu world! With several systems to guide your very actions and several people willing to rp with you where could things go wrong? immerse yourself in our very own Bleach universe, and interact with fellow fans. With engaging roleplay, thrilling storylines, and a welcoming community, this server is the ultimate destination for fans of all ages. Don't miss out on the chance to explore the vast world of Bleach and create unforgettable memories with like-minded enthusiasts. Join now and let’s start up this journey today, Karakura town is awaiting you!*** **Our own unique take on Bleach, you took the time to read this far so we KNOW you’re interested!** **``We offer: A forum based oc submission system where we can easily interact with you and point out certain details Several different templates for multiple different things such as weaponry, zanpakuto, and the different races showcased in the anime/manga! An active staff team The chance to influence the story or have your own arcs Be part of the main cast! Everyone is really, I mean it! A multitude of different systems for important techniques and skills such as the transformations (such as bankai, shikai, training, resurrecion and mastery) A lot of channels that give background information on what you can do with the bleach power systems so even if you haven’t actually seen the series or read the manga you could read up for a basic understanding! The chance to utilise cool transformations, zanpakuto's, kido spells, or even create your own Influence a moving plot a money system a moving story and a chance to give your own two cents``** ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Links: https://discord.gg/uKK8Q3nggG [let's go, your journey starts now!](https://tenor.com/bQ7nQ.gif) Pings: ||@everyone @here||

Today's activity
1💬
116🟢
1👥
0📞
Server overview
518👥Total members
1📅years old
13+Age requirement
server profile pic
Hyperwarp Bewerbung
deutschgermanroleplayrollenspiel
Description

Dem server dem ihr joinen wollt, ist ein Invite only Server und nur für Leute gedacht denen wir vertrauen/die vertrauenswürdig sind. Auf dem Server gibt es keine wirklichen Regeln die einen im rp einschränken, es liegt hauptsächlich bei euch darauf zu achten das alles möglichst Fair bleibt, bei extrem Fällen werden wir als team dennoch eingreifen.

Today's activity
1💬
7🟢
1👥
0📞
Server overview
7👥Total members
1📅years old
14+Age requirement
Description

The official server for the Connected Skies based roleplay forum, Eo Genesis. We have a 100 word minimum IC post cost, and we do our roleplaying on Proboards. The link is in our rules section. We have many species to choose from, and a deep lore to go off of. Come join us, we're super friendly. Our staff have a combined experience of over 20+ years, and we're very fair. We're not uptight like a lot of places lol

Today's activity
1💬
8🟢
1👥
0📞
Server overview
14👥Total members
1📅years old
13+Age requirement
Description

[QUICK DISCLAIMER: This is a ROLEPLAY server. If you are here to trade, do not join.] 2 worlds exist, the human world, and the Yo Kai World. They used to be separate, but some time, long ago in the past, their borders got hazy and Yo-Kai started to pour in, and cause all sorts of troubles for humans! Completely invisible to the human eye, they inspirit people and cause problems ranging from the mild annoyance to major danger. Luckily, a device exists to allow humans to see and even befriend the Yo-Kai! Can a peace be reached between the 2 worlds, or is an unseen catastrophe right on the horizon?

Today's activity
1💬
39🟢
1👥
0📞
Server overview
238👥Total members
5📅years old
13+Age requirement

211 servers found