Roleplay Discord servers

🔎 Search
🏷️ Tags
🔞 Age Requirement
📊 Sorting
👥 Server Size
📅 Server Age

210 servers found

server profile pic
The Writer's Library {{21+}}
friendlysocialroleplayrpcommunitywritingroleplayerroleplay partnerwritersactive
Description

Welcome to the Writers Library. All writing levels are welcome! We are a 21+ Role Play server. We do request your work be human written. Here you can find yourself lost in the pages of your own creations and meet other writers to join you.

Today's activity
7.2k💬
108🟢
66👥
13📞
Server overview
296👥Total members
7📅months old
21+Age requirement
server profile pic
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
5.2k💬
76🟢
29👥
0📞
Server overview
239👥Total members
2📅years old
13+Age requirement
server profile pic
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
17💬
27🟢
6👥
0📞
Server overview
129👥Total members
1📅years old
16+Age requirement
server profile pic
RP n’ Chill
role-playroleplay
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
1.8k💬
186🟢
22👥
0📞
Server overview
1.1k👥Total members
5📅years old
15+Age requirement
server profile pic
It's Your Power!
roleplayrpmhamy hero academiamha-rproleplayingmy hero academia-roleplay)my hero academia-rppartnership
Description

🌟 IT’S YOUR POWER! — MY HERO ACADEMIA RP 🌟

🦸‍♂️ Do you have a hero OC?
🦹 A villain with a cause?
👤 Or a civilian just trying to survive in a superpowered world?

It’s Your Power! is a My Hero Academia–based roleplay server set in a post-war, hybrid timeline, where hero society is rebuilding—and redefining itself.

In this world, most humans possess Quirks, superhuman abilities that shape daily life, careers, and conflict. Hero schools still stand, villains still lurk, and the line between right and wrong has never been thinner.

What sets us apart?

✨ Play who you want.
You’re not limited to hero students. Play:
Hero students, Pro Heroes, Villains, Vigilantes, Civilians, Support and business roles
…and more.

🏫 Multiple Hero Schools

U.A. High School

Shiketsu High School

Deika City University (DCU) — a bold, experience-first hero institution

📖 Story-Driven World
The world reflects the consequences of canon events, while leaving room for player-driven stories, growth, and server-wide arcs.

🌈 Inclusive & Community-Focused
Whether you’re here for intense plots, character development, or casual RP, there’s a place for you.

🔹 What We Offer:

• Friendly and welcoming community
• Clear rules and active staff
• Self-assignable roles
• Open RP channels (no forum locking)
• RP events and story arcs
• LGBTQ+ friendly environment
• Unlimited original characters
• Canon characters available to claim
• Partnerships welcome

Step into a world where power doesn’t define destiny.

It’s not about the Quirk you’re born with.
It’s about what you choose to do with it.

💥 It’s Your Power! 💥

Today's activity
4.7k💬
63🟢
44👥
0📞
Server overview
142👥Total members
3📅months old
15+Age requirement
server profile pic
Fluid Client
communitysocialactivechillroleplaygaminghangoutgamescreativefriendsfunfriendlyartchatmusicvcsfwrobloxminecraft
Description

Ready to take your Minecraft adventures to the next level? Fluid Client, the unrivaled Minecraft client for 1.8.9, is your ticket to endless possibilities! 🌍 Unleash your imagination, conquer challenges, and build your way to victory! Download now at https://fluidclient.ovh/download.

Today's activity
25💬
419🟢
12👥
0📞
Server overview
10.1k👥Total members
2📅years old
13+Age requirement
Description

𝐒𝐄𝐕𝐄𝐍.. 𝐒𝐈𝐗... 𝐄𝐋𝐄𝐕𝐄𝐍... 𝐅𝐈𝐕𝐄... 𝐍𝐈𝐍𝐄 𝐀𝐍' 𝐓𝐖𝐄𝐍𝐓𝐘 𝐌𝐈𝐋𝐄 𝐓𝐎-𝐃𝐀𝐘... 𝐅𝐎𝐔𝐑... 𝐄𝐋𝐄𝐕𝐄𝐍.. 𝐒𝐄𝐕𝐄𝐍𝐓𝐄𝐄𝐍.. 𝐓𝐇𝐈𝐑𝐓𝐘-𝐓𝐖𝐎 𝐓𝐇𝐄 𝐃𝐀𝐘 𝐁𝐄𝐅𝐎𝐑𝐄..

⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆
est. 7th November 2023. The most long lasting, active vibey aot rp server you'll ever find. **SERVER TAG + EXCLUSIVE ROLES!!** ( and 24/7 poketwo)

Interested in joining a chill out aot rp server on disc thats also active, with amazing and hilarious (and actual NON toxic) members? This server supports all styles of RPing. Here's why you should join:
╰┈➤There are SO many available canon characters to choose from, (and by choosing a canon, you're also guaranteed a unique role, [yes- even the "minor side characters"] no service required!) and we LOVE OCs!! There are many activities that take place including royal balls/galas, battles, path sequences and so much more.. and even an actor au! ╰┈➤The server allows you to focus on your character as well as their interactions with others. NO ONE is ever left out in the plot.
╰┈➤Choose where your character comes from (if an OC) I.E Marleyan or Eldian. There are loads and loads of different channels, (including Marley, beyond the walls, and more!) This server also doesn't have an over-the-top combat system or rules, you can go crazy! (just not OP.)
╰┈➤The plot has a perfect balance of comedy, combat, romance, serious RP and many tear jerking moments.
╰┈➤ This server is perfect for any RPer who is just starting out, getting back into the fandom, or just wants a chance to show off some writing. But wait, there's more!
╰┈➤ We don't just do RP here. We have regular silly VC's, music nights, game streams, UNO, and many more! With that said, thank you so much and I know we'll all be able to give eachother a memorable RP experience!
⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆

𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒... 𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒.. 𝐌𝐎𝐕𝐈𝐍' 𝐔𝐏 𝐀𝐍' 𝐃𝐎𝐖𝐍 𝐀𝐆𝐀𝐈𝐍.. 𝐓𝐇𝐄𝐑𝐄'𝐒 𝐍𝐎 𝐃𝐈𝐒𝐂𝐇𝐀𝐑𝐆𝐄 𝐈𝐍 𝐓𝐇𝐄 𝗪𝐀𝐑.

Today's activity
5.1k💬
136🟢
47👥
0📞
Server overview
512👥Total members
2📅years old
13+Age requirement
server profile pic
Avalon Community | Dedicated Servers & Real Players
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
26💬
120🟢
5👥
0📞
Server overview
1.0k👥Total members
8📅years old
13+Age requirement
server profile pic
City in the Sky
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
1.1k💬
348🟢
66👥
0📞
Server overview
2.9k👥Total members
1📅years old
13+Age requirement
server profile pic
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
1.2k💬
86🟢
34👥
1📞
Server overview
330👥Total members
3📅years old
16+Age requirement
server profile pic
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
703💬
958🟢
69👥
52📞
Server overview
6.2k👥Total members
5📅years old
13+Age requirement
server profile pic
The Funnybunny Street Corner (21+)
tadctadc rpthe amazing digital circusroleplaythe amazing digital circus rp
Description

WE ARE NEW! A 21+ roleplay server aimed towards people who wanna write and have fun! Here you'll find NPCs, OCs, partnerships, and game nights with friends! We have literate and crack roleplay channels as well as places to post all your wonderful media!

TAKEN CHARACTERS:
JAX
CAINE
POMNI
EVIL JAX

6 OC SLOTS OPEN!

COME JOIN AND BECOME THE DIGITAL DISASTER YOU WERE MEANT TO BE.

Today's activity
773💬
14🟢
9👥
0📞
Server overview
18👥Total members
4📅days old
21+Age requirement
server profile pic
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
717💬
2.0k🟢
42👥
6📞
Server overview
12.5k👥Total members
9📅years old
13+Age requirement
Description

ꕤ˖⸝⸝₊˚ Heiwa: 𝐆𝐨𝐥𝐝𝐞𝐧 𝐅𝐚𝐭𝐞 — a Medieval Fantasy Roleplay Server Long ago, the Epoch Shift shattered history; revealing a hidden orange-glowing moon, Nimiel, and changing the world as we know it. Civilizations now rise from the ruins, rediscovering old gods, lost kingdoms, and mysterious crystals embedded deep within the land. Ecosystems evolving far faster than we can keep up with, people redefining themselves and their lives. In this world, magic is a muscle, not an infinite force. Each spell strains the body. Power comes from training, endurance, and discipline. Your story begins here - when anything and everything you do can change the course of the story, how will you choose to live? 𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃 Heiwa is currently in a TRIAL PHASE. From now until NEW YEARS, the server is open for character-making and roleplaying, but no important lore events will occur. If you want to get in to make a mark before we truly kick off, now is the time! Deep, original lore (two moons, a shattered epoch, divine politics, unique magic system) Friendly, active community OC-focused, literate & semi-literate roleplay Medieval fantasy aesthetic Multiple regions, factions, and cultural paths Helpful staff, open channels for new players Event-driven storytelling + player-driven plots Safe, welcoming environment for all Ready to step into the new era? Join the world shaped by Mōna and awakened by Nimiel. Your story awaits.

Today's activity
18💬
49🟢
3👥
0📞
Server overview
100👥Total members
4📅months old
13+Age requirement
server profile pic
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
1.9k💬
32🟢
21👥
9📞
Server overview
134👥Total members
2📅years old
14+Age requirement
server profile pic
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
414💬
67🟢
12👥
2📞
Server overview
205👥Total members
3📅years old
13+Age requirement
server profile pic
DECEIT [RP]
communityroleplayrp
Description

˗ˏˋ ✞ ˎˊ˗ 𝐃𝐄𝐂𝐄𝐈𝐓 ˗ˏˋ ✞ ˎˊ˗ “I will not tell you the visceral details as you already know them, you all do. It's happening to every-body.”
═══════════════
On the eve of the outbreak, Southwood, Alabama's population sat at 8,000. Now? hundreds, a bustling coastal city transformed into nothing more than a shell of it's former glory. It wasn't always this way, yet an inconceivable turn of events left thousands wondering if hope was well and truly lost. You weren't lucky enough to be picked up by the military convoys that left town at the behest of the United States Government, no, you were left behind, discarded, and no matter how unhappy you were about that fact, nothing could change how you were now among Fairhope's last remaining inhabitants. There was no telling just what could happen, the cataclysm of the world as we know it was sure to bring about some major changes. Were you going to embrace it, or desperately cling onto whatever hope humanity had left..?
═══════════════
“No-one you know is a good person.”
═══════════════
What Deceit Offers... {✞}

HORROR + APOCALYPTIC THEMES — Built by a team of previous apocalypse-RPers, Deceit offers a range of apocalyptic themes within it's plotlines, all based in the fictional coastal town of Southwood, Alabama . We don't merely focus on the dark, gritty aspects of the apocalypse, but also the wider picture. We aim to make our world as immersive as possible so that everyone can get the most enjoyment out of roleplaying here.

{✞} CREATIVE SPACE FOR ALL SKILL-LEVELS — With the rise in AI over recent years, we've noticed a severe lack in creative spaces. Deceit offers a creative outlet for writers of all skill-levels, whether you're literate writer who wants to improve their work, or a multi-paragraph writer who wants to tell an immersive story, there's a place for you here. AI is banned entirely.

{✞} INTERACTIVE LORE — We've implemented not only a D20 system, but also certain guidelines for events that mean your choices matter. There are real stakes behind every choice your character makes, meaning every single session carries a unique sort of tension. {✞} MEMBER FEEDBACK — Ultimately, we are not immune to taking criticism. If there are certain aspects of the server that you think could be improved upon, then tell us so we can ensure a positive experience for everyone.
═══════════════

Today's activity
137💬
21🟢
6👥
0📞
Server overview
43👥Total members
2📅years old
13+Age requirement
server profile pic
Rus' | Into The Frost
adventurefantasymedievalroleplay
Description

With a long winter preparing to encapsulate the Tsardom of Rus' and all living things within the Russkaya Zemlya, we invite you to join us in the new and improved Rus' Universe. Dobro pozhalovat' v Rus! Welcome to the Rus', my friend. The "Rus' | Into The Frost" is a server based on 15th-Century Medieval Russia with a fantasy twist. Imagine a world where legendary creatures found in traditional folklore coexisted alongside ManKind. It is in our universe that adventurers from all corners of the globe travel to the Land of the Rus' to test their mettle against the ferocious beasts that dominate the cold lands. Limited by only your own brilliant creativity, you are allowed to start off as a majestic and nimble Kitsune from the Far East—using magic to turn your foes to dust. You can even try to slay beasts as an Elven Archer from the Germanic Region who can strike down their prey from miles away, a werewolf, vampire, orc, and so much more. Don't be afraid to strive for whatever your artistic mind desires. This is a community that accepts all passionate to write, role-play, and help build an immersive universe influenced by its members and everything we do as a community. Upon joining, we ask that you take the time to read the instructions provided in our welcome channel. We are a very well-written and fleshed-out server. We hope that you'll be joining us very soon on our courageous adventures, friend.

Today's activity
194💬
16🟢
9👥
0📞
Server overview
40👥Total members
3📅years old
18+Age requirement
server profile pic
/saucee | ask2dm • egirls • dating • social • active
communitysocialchillroleplaygamesanimefriendsactivemoviesdatingegirlactive-voicechatedatingfreakyvc
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
190💬
146🟢
46👥
5📞
Server overview
2.1k👥Total members
1📅years old
18+Age requirement
server profile pic
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥
dungeons and dragonsd&dttrpghobbiesdndtabletoproleplay
Description

The City of Brass is a place for people to share and discuss their hobbies, favorite media, and worldbuilding projects; whether it be for a tabletop game like Dungeons and Dragons, or just for the fun of it! We also like to make and give/receive feedback on Hombrew content for D&D!

Today's activity
369💬
30🟢
10👥
0📞
Server overview
81👥Total members
4📅years old
18+Age requirement
server profile pic
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
84💬
41🟢
7👥
0📞
Server overview
154👥Total members
4📅years old
15+Age requirement
server profile pic
The Darkness rises
roleplaywingsoffirewofdragonscommunity
Description

This is a wings of fire Roleplay server! This takes place after the books and pantala was hidden for a while before being re born! And re introduced. But there’s a catch, weird hybrid royalty started to hatch from the hivewing Queen? As in tribes of 5 of 8 of 10? Even 11?

The Allwing that lies there has a fate bigger then he relized, but it’s split in half? His father wants him for the wars on the other continent. His mother wants the peace and fate dragoness start to appear along with a song with deeper meaning.. will that darkness rise or will peace fall among everyone? Only you have the power to decide!

We have a large arrangement of channels to pick from, lore that constantly updates and grows and staff that have open hearts to help with any questions or concerns!

We try to stay active with sorted day to night changes, weather changes and sometimes channel changes! If you have a character that cannonly has a shop? Just let me know and I don’t mind adding it! Have a Prince that has a special room? We can add it! Do you have a stronger character or a unique looking one? Just let us know and we will make a way for you to add it!

We also have art and writing events! If it’s having a party at party hive or showing of your dragons green thumb there are many options for art and writers!

Come on down and have some fun! We welcome all with open talons!

Other things we have:
-open prince and princess spots
-Adopts
-Raffles
-Ranting areas for characters

We hope to see you there!

Today's activity
53💬
15🟢
5👥
0📞
Server overview
52👥Total members
2📅years old
15+Age requirement
server profile pic
Divinity's Rapture
communityroleplayroleplayingchillsocialanimelgbtq+fireemblemfe3h18+anime rp
Description

(SFW RP, but hidden ooc nsfw channel)

(Past and "modern" versions of characters are, essentially, separate people, and exist at the same time.)

The year is 1885, nearly 700 years after the War of Unification for Fódlan. Peace and prosperity reigned across the land as students far and wide made their way to the esteemed officers academy. A professor awaits for a new opportunity to teach as three important heirs make their way to Garreg Mach alongside their comrades. Little did any of them know however the peace they knew would come crashing down. Those from the past arrived both friend and foe. While the newly lost Fell Star seeks to restore balance and preserve this world the King of Liberation and his allies move to conquer and destroy. For the past was never meant to encounter the future and the dead should have been left to rest. Memories blur as the inhabitants of Garreg Mach attempt to understand who they are and what this all entails.

(Welcome to Divinity’s Rapture! An FE3H time travel au featuring the messy attempts at finding a perfect ending and the consequences that follow. Follow the story as the past is flung into an alternate far future all while reality desperately attempts to piece itself together. )

Today's activity
47💬
18🟢
8👥
0📞
Server overview
46👥Total members
11📅months old
18+Age requirement
server profile pic
the Eternity
horrorroleplaywriting
Description

a new, somewhat horror based rp server set in a luxury hotel. Ocs and canon characters are allowed. We're just starting off, so join now!

Today's activity
31💬
8🟢
4👥
0📞
Server overview
17👥Total members
2📅years old
16+Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
4.8k💬
124🟢
45👥
2📞
Server overview
708👥Total members
6📅years old
14+Age requirement
server profile pic
𝗗𝟰
communitysocialchillgamingroleplaygameshangoutanimefriendsfunfriendlyartchatmusicactiverobloxvcsfwminecraftlgbtq+memesmangarpeventspoliticsvaloranthorrorenglishnon-toxicprogramminganime rpaireading13+egirlslgbtqcatslgbtq friendlyteenactive-communitysportstechnologyfootballvoice chatnontoxicgamersbooksmusic producersegirlbookclubcutegtaadultsvoice-chatemojiartsmusicianteensgoofyweedactive-voicechatsmoking420gamerapexteen-friendlyhouse of the dragonanime rpgvcsemojisfun factsgame nightsvaporwavetechnicallgbtq+ friendlygame-devraidsno toxicitygta vdevelopershang outpersonal developmentmusic botsemoclassical musiceboystomb-raidersoccerstorytechlgbt friendlysocial community vc fun friendlyraidingskateboardinggamer-girlsweebnukevapingeboyd4gamer-girlskatingscooteractive voice chatraiderssk8stonervaporprogrammersskatergamergirlpartnershippartnershipspartnerpvppcskateskateboardskawritingmoviemovie nightmoviesmovie nightsfilm
Description

𝗗𝟰 𝗶𝘀 𝘁𝗮𝗶𝗹𝗼𝗿𝗲𝗱 𝘁𝗼 𝗮𝗹𝗹 𝗽𝗲𝗼𝗽𝗹𝗲 𝘄𝗵𝗼 𝗷𝗼𝗶𝗻.
● sғᴡ → ᴀʀᴛ
● ᴛᴇᴄʜ → ᴀɴɪᴍᴇ
● ᴍᴜsɪᴄ → ᴍᴇᴍᴇs
● ᴇᴠᴇɴᴛs → sᴏᴄɪᴀʟ
● ᴀᴄᴛɪᴠᴇ → ᴠᴀᴘᴇʀs
● ᴇ-ʙᴏʏs → ʜɪᴘᴘɪᴇs
● ɢᴀᴍɪɴɢ → ᴇ-ɢɪʀʟs
● sᴋᴀᴛᴇʀs → sᴛᴏɴᴇʀs
● ᴇǫᴜᴀʟɪᴛʏ → ᴀᴛʜʟᴇᴛᴇs
● ᴍᴜsɪᴄɪᴀɴs → sᴛʀᴇᴀᴍɪɴɢ
● ʀᴀᴘ-ʙᴀᴛᴛʟᴇs→ ɴᴏɴ-sᴛᴏɴᴇʀs
● ᴘʀᴏɢʀᴀᴍᴍɪɴɢ → ᴄʏʙᴇʀ-sᴇᴄᴜʀɪᴛʏ
● ᴄᴀᴛᴄʜɪɴɢ-ᴘᴇᴅᴏs → ғʀᴇᴇ-ᴇxᴘʀᴇssɪᴏɴ
● ᴀɴᴛɪ-ᴄᴏʀʀᴜᴘᴛɪᴏɴ → ᴍᴜsɪᴄ-ᴘʀᴏᴅᴜᴄᴇʀs
● ᴄᴏɴᴛᴇɴᴛ -ᴄʀᴇᴀᴛᴏʀs → ᴘᴏᴇᴛʀʏ ᴀɴ ǫᴜᴏᴛᴇs
𝗧𝗵𝗲 𝗽𝗲𝗿𝗳𝗲𝗰𝘁 𝗽𝗹𝗮𝗰𝗲 𝗳𝗼𝗿 𝗺𝗲𝗲𝘁𝗶𝗻𝗴 𝗻𝗲𝘄 𝗽𝗲𝗼𝗽𝗹𝗲 𝗲𝘃𝗲𝗿𝘆𝗱𝗮𝘆.

NON-TOXIC

Today's activity
797💬
146🟢
41👥
4📞
Server overview
740👥Total members
10📅months old
13+Age requirement
server profile pic
Якудза
socialchillgaminggamesworld of warcraftjapancommunityroleplayanimefriendsfunfriendlyartchatactivemusicmemesmoviesrpmangaeventsprogrammingcreativenon-toxicvoicechattingreading
Description

Невыносимые ограничения, дотошные лицемерные правила... Устали от всего этого? Ищете взаимопонимания? В нашем самом вольном объединении рады всем, кто на стороне Справедливости.
Вступайте в семью!

Мы - атмосферное сообщество, объединяющее людей разных фриланс-профессий, талантов и интересов. Наш оригинальный подход направлен на поддержание духа свободы и взаимопомощи.

На нашем уютном сервере вы найдёте:
✓ Приветливое сообщество фрилансеров с анкетами для работы
✓ Дизайнерскую стилизацию под японскую тематику с аутентичными картинками и философскими фразами с глубоким смыслом
✓ Уникальную демократическую систему политической жизни сервера с выбором клана
✓ Разнообразные чаты для вольного общения, игр и интересов
✓ Своя вольная гильдия без требований в World of Warcraft
✓ Полную свободу выбора и действий

В нашем самом свободном сообществе каждый найдёт для себя своё место!

Помните главное:
Вместе мы подобны течению десяти тысяч рек, впадающих в океан. Объединение - вот ключ к успеху.

Today's activity
707💬
21🟢
30👥
23📞
Server overview
87👥Total members
2📅months old
16+Age requirement
Description

*A girl moves house with her mother and discovers that it was her childhood home where her sister went missing. The forest next to the house draws her in and she wakes up there every night at 1am ever since she first explored. She meets a bunch of people from all different points in time who are also stuck in the forest. They have to fight off all kinds of monsters together and have a few laughs on the way before tragedy.*

Today's activity
7💬
17🟢
3👥
0📞
Server overview
114👥Total members
1📅years old
13+Age requirement
server profile pic
KRAKENS REACH - BERMUDAS DEPTHS
socialcommunitychillgaminghangoutwritingeventsrpoccasuallore
Description

The central hub for the beloved Bermudas Depths community, and the house of the Krakenborn. Sip a few beers and praise the Kraken! (This server is application only; the questions are not advanced, they are simply to get you into the right mood for the server.) A developing storyline set in an alternate dimension of the Bermuda Triangle, where demons prey on unsuspecting lost souls... Participate in contests to develop the setting, enjoy reading lore and asking questions about it, play in gamenights, roleplay, or simply exist. We don't mind whichever path you choose.

Today's activity
12💬
11🟢
4👥
0📞
Server overview
20👥Total members
4📅months old
13+Age requirement
server profile pic
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
954💬
63🟢
34👥
20📞
Server overview
1.2k👥Total members
3📅years old
13+Age requirement
Description

***TOKYO GHOUL - TRIBUTES***

*This server is 16+!*
It is modern day Tokyo. Years have passed since the Dragon War. Faux allyships between Ghoul and Mankind have crumbled like castles under poor leadership and glorified silver linings. From the ashes rose tired, angry, and vengeful ghouls that were given fragile promises and hope at living a normal life.

The United Front and newly-instated CCG, lead by Matsuri Washuu, are now at war. The CCG believes that it is their rightful title as Japan's proper justice division and that all ghouls must be executed as a means to prevent a third-wave’s occurrence as well as another Dragon Incident. The wards have been distorted in chaos underneath the surface, as constant warring over Tokyo's wards appears to be never-ending.

The strange world just got stranger. The dead are mysteriously rising, old organizations are returning with new faces and new leadership, and the ghoul and human worlds as we know it are headed for significant changes.

Here there is a very lax ranking system, meaning that, until the free-spots are filled for higher ranking ghouls / investigators you may have to have your character be higher ranked. For those that miss out, do not fret. We are solely-activity based, meaning the longer / more active you are the higher the rank you can become via the Arcane bot level system **in roleplay channels only**. Both canons and original characters are welcome. Create your own paths - your lore is incorporated into the server's lore. Have fun and enjoy your stay!

*What we offer*

- Unlimited OCs
- A complete, unique server with all 24 wards and location channels within them
- Semi-lit - Adv. Lit RP
- A small but growing community of friendly, creative people
- Canon Character roles
- Gartic, music bots and streaming voice chats

Today's activity
284💬
9🟢
2👥
0📞
Server overview
44👥Total members
2📅years old
16+Age requirement
server profile pic
Test Subjects Official Roleplay
sciencehumansroleplayrealtestinglab
Description

✨ Welcome to Test Subjects ✨

⚙️ The Facility:
A secret lab where science pushes boundaries.

🔬 Roles:

Test Subject: Endure experiments, gain powers or mutations.

Scientist: Conduct experiments, manipulate subjects, chase breakthroughs.


🧬 What Awaits:

Powers, mutations, or failures.

Dangerous tests.

Power struggles, escape attempts, and secret agendas.


🧪 The Question:
Will you thrive, rebel, or control the chaos?

Step into the lab... the experiment begins now.

✨ Welcome to Test Subjects ✨

⚙️ The Facility:
A secret lab where science pushes boundaries.

🔬 Roles:

Test Subject: Endure experiments, gain powers or mutations.

Scientist: Conduct experiments, manipulate subjects, chase breakthroughs.


🧬 What Awaits:

Powers, mutations, or failures.

Dangerous tests.

Power struggles, escape attempts, and secret agendas.


🧪 The Question:
Will you thrive, rebel, or control the chaos?

Step into the lab... the experiment begins now.

Today's activity
32💬
10🟢
2👥
0📞
Server overview
25👥Total members
1📅years old
13+Age requirement
server profile pic
Cat House
catsgamesfurryfemboyroleplayidk
Description

This is new server idk what it about u may join and help find out (waw what rhymes)

Ignore tags i wrote what i liked this can change soon!

Today's activity
12💬
11🟢
1👥
0📞
Server overview
20👥Total members
2📅years old
16+Age requirement
server profile pic
Grim Circus
roleplayfunrpocblyaoicircushorrorromance
Description

A yaoi rolepay server loosely inspired by the Dark Woods Circus song
------
A circus rolls into town, the sound of a train on long abandoned tracks, tents set up at the edge of town. The forms of the performers is strange, a deformed beauty with the voice of an angel, the ringmaster with the glowing eyes and pointed teeth hidden behind a charming smile.
As men start to go missing, the circus vanishes just as suddenly as it was set up, the only evidence it was ever there is popcorn and hay scattered and trodden into the grass
At the next town, new faces can be found among the members of the circus and there is fresh meat on the plate of the freakshow's cannibal. At the end of the show odd features can not be removed.
The charming ringmaster has tricks up his sleeves. A witch twisted by solitude and torture, he collects boys and twists them like he was, changing their appearance to his fancy with surgery and magic, taking apart those who do not meet his standards for parts, disposing of what he can't use in the bellies of beasts. His collection is cursed and bound so they can never abandon the circus.
Once you are lured into the circus you can never leave.
Are you ready to join the circus?
------
Please only join if you are 18 or older, We'd like to fully be able to explore the horror themes that could apply to the setting. It is however sfw in the main areas.

Today's activity
5💬
7🟢
2👥
0📞
Server overview
21👥Total members
6📅months old
18+Age requirement
Description

With three main factions to choose from (or even choose none if you want), here you can have pretty much any OC you could possibly want here, without the planet nuking power players getting in the way of your fun! With the main Nikko Highschool, you can be a student, teacher, or any other staff member. Or maybe be part of the Nous Corporation, a more tech focused Faction compared to the school. Perhaps you'd rather get up to some crime and mischief? Be part of the Warui Cult and it's ranks, a group of criminals are dark magic practicioners that feels a bit too much like a home. All of it can be done here!
Fandom OCs, furry OCs, even your own unique powers and species are all allowed here, so hop in and have fun!

Today's activity
3💬
21🟢
2👥
0📞
Server overview
32👥Total members
6📅years old
13+Age requirement
server profile pic
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★
roleplaysocialcommunitychillanimehangoutcreativemangaliterateocbleachbleach rpbleach roleplayanime rpanime roleplaymanga rp
user profile pic
coolin.real15-11-2024 18:14

hi guys!

Description

[**``黒— ★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★``**] ***Join our server for an interesting run, an adventure throughout multiple different worlds and realms, a deeper perspective on several different races and untold stories in this entirely new world. You may fight strong opponents, take on new heights, push yourself beyond your limits and even face off against those above! With or without a purpose, be a an active participant in the lore of our server that revolves entirely on you all. Destroy the strongest hollows or even reapers, quincies, fullbringers, humans (hell anything you name it) this era has ever known or just simply do your own thing; Awaken a bankai, shoot arrows, become an espada or develop a mask! The opportunities are practically endless in this Mugetsu world! With several systems to guide your very actions and several people willing to rp with you where could things go wrong? immerse yourself in our very own Bleach universe, and interact with fellow fans. With engaging roleplay, thrilling storylines, and a welcoming community, this server is the ultimate destination for fans of all ages. Don't miss out on the chance to explore the vast world of Bleach and create unforgettable memories with like-minded enthusiasts. Join now and let’s start up this journey today, Karakura town is awaiting you!*** **Our own unique take on Bleach, you took the time to read this far so we KNOW you’re interested!** **``We offer: A forum based oc submission system where we can easily interact with you and point out certain details Several different templates for multiple different things such as weaponry, zanpakuto, and the different races showcased in the anime/manga! An active staff team The chance to influence the story or have your own arcs Be part of the main cast! Everyone is really, I mean it! A multitude of different systems for important techniques and skills such as the transformations (such as bankai, shikai, training, resurrecion and mastery) A lot of channels that give background information on what you can do with the bleach power systems so even if you haven’t actually seen the series or read the manga you could read up for a basic understanding! The chance to utilise cool transformations, zanpakuto's, kido spells, or even create your own Influence a moving plot a money system a moving story and a chance to give your own two cents``** ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Links: https://discord.gg/uKK8Q3nggG [let's go, your journey starts now!](https://tenor.com/bQ7nQ.gif) Pings: ||@everyone @here||

Today's activity
3💬
117🟢
3👥
0📞
Server overview
498👥Total members
1📅years old
13+Age requirement
Description

"You'll face death, and it won't be pretty.
Enough death to leave your broken, time and time again...."

Congratulations! The application you submitted to become a part of Project Epsilon has been accepted! Welcome aboard!

Hello and a warm welcome to Halo: Project Epsilon! This is a server where you take the role as an agent of Epsilon. You will embark on a whole variety of missions to various ancient and fantastical planets (created by yours truly) to combat the rising power of the evil Red Talon corporation. While working alone in this server is plausible, it is also foolish. We here at Epsilon are huge advocates for teamwork as it not only improves overall RP experience, but it also leads to more interesting and diverse scenarios for you and your new friends to enjoy. You heard me right, friends! Epsilon gladly welcomes anyone of any race, culture, background or identity, regardless of whether or not you are a member of the LGBTQ+ or if you are just an 8ft tall Sangheili, we are all friends here!

This is based on Red VS Blue’s project freelancer and is a custom rp server that involves:
- Team based mission RP 🕴️
- A competitive leaderboard to flex on all your pals 💪
- Frequent and inclusive events (nitro) 🫨
- Friendly staff who will be your new best friends 😎
- Acceptance of everyone, unless you are from Formby, which case I want my money back 🏳️‍🌈
- POKECORD 🦆
- Comedy 🤓
- Women (I think)🤷
- HUNGER GAMES! 🕺
- CQ Cumber 🐐
So if you like what I described and you think this server fits your vibe. Join! I would love to see you there and so would everyone else. If you still have any questions then all you got to do is ask me or our dedicated staff team (I love them) who will gladly offer assistance to solve any quibbles and quabbles you may have. I truly hope to see you there.

-Colorado

Today's activity
3💬
33🟢
2👥
0📞
Server overview
130👥Total members
6📅years old
13+Age requirement
Description

+ ━━━━☆ WELCOME TO THE GREENFIELD ACADEMY! ☆━━━━ +

Embark on a thrilling journey into the extraordinary at Greenfield Academy, where the year is 2044, and a new generation of heroes is rising. Dive into a captivating server where you have the power to shape your own original characters and unfold epic tales of heroism and discovery!

✨ Unleash Your Superhuman Potential ✨

Step into the bustling metropolis of Charter City, home to Greenfield Academy, a prestigious institution for molding future heroes. The students possess unique powers inherited from their grandparents who experienced an event known as "The Black Hole Incident." Explore a world where extraordinary abilities are the norm, and the line between hero and villain blurs.

🦸 Craft Your Heroic Legacy 🦸

Create your very own OC, from their compelling backstory to the depths of their superhuman abilities. Immerse yourself in a universe that celebrates originality, where your character's journey is untethered from existing storylines. Join forces with other members to weave tales of heroism, friendship, and self-discovery.

🚀 Soar Above the Rest 🚀

Here at Greenfield Academy, originality reigns supreme. Engage in a rich lore, explore diverse channels to enhance your OC's story, and immerse yourself in a non-toxic community that values creativity and collaboration. We understand the importance of real life, so join roleplays at your own pace without pressure.

What We Offer

- A unique roleplaying experience within the Greenfield Academy universe.
- Diverse channels for character development (Designs, Theme songs, Headcanons, Etc.).
- A welcoming and non-toxic community.
- Flexibility in roleplay participation, attend when you can.

Join us at Greenfield Academy, where destinies are forged, and the legacy of the next generation of heroes begins. Uncover your superhuman potential and let the adventure unfold!

Join the Journey Today!

Today's activity
3💬
27🟢
2👥
0📞
Server overview
93👥Total members
3📅years old
13+Age requirement
server profile pic
Under Claw - Explore Tarragon
d&droleplaydnddungeons and dragonswestmarchwest marchesdndd&ddungeonsdragonstabletoponeshotone shotlfgttrpgpathfinderp2epathfinder 2e
Description

OICE RP - WEST MARCH - SINGLE GAME MASTER - HIGH QUALITY A custom tabletop system written by me, familiar to 5e but vastly different. You've awoken in the small village of New Flame, with only distant fading memories of your life before. An ashen stone rolled from the Boiling Pools, cracked open to reveal your soundly sleeping form wrapped in ceremonial white cloth trimmed with silver lace. You have become Ashen Born, and you've no way to return to what was before. Your new home is a ruined and ransacked town full of hopeless wretches akin to yourself, having abandoned thought of stepping beyond the towns walls. Many have died attempting to do the same, and after all, it's safe here.  Supposedly, great beasts inhabit the lands beyond. Many choose to venture outside of New Flame in hopes of answers, and a way home. The terrifying roars of those who call the wastes home are followed shortly by screeches of terror, cries of pain, and then silence. The desert sands to the east carry sound surprisingly well. A horrific warning that almost seems by design.  Despite this, you are not content to wither away with the other cowards. Scavenging for supplies in the ruins, eating nothing but birds, lizards, rats, and the occasional wild vegetable as a luxury. You cannot accept that there is no purpose for your arrival, you will not lay down and rot like so many of those who came before you, and you are not willing to die here without a fight.

Today's activity
3💬
16🟢
3👥
0📞
Server overview
30👥Total members
2📅years old
18+Age requirement
Description

A pretty chill Kirby Roleplay server. Just follow the rules and you’ll have fun. We’re currently a small server and we hope to see you join

Today's activity
2💬
37🟢
1👥
0📞
Server overview
78👥Total members
11📅months old
13+Age requirement
server profile pic
🍻 Dead Mans Drink - Project Zomboid Community Server
project zomboidgaming servergamingzomboidzomboid serverproject zomboid serverroleplayrpproject zomboid roleplayproject zomboid rprppvp
user profile pic
obeseman44409-02-2025 21:54

YEAH

user profile pic
lolacopacabana10-02-2025 02:24

Dead Man's Drink - Project Zomboid Community Server

user profile pic
lolacopacabana10-02-2025 12:45

🔥

user profile pic
lolacopacabana10-02-2025 14:45

🔥

user profile pic
lolacopacabana10-02-2025 18:41

🫡

user profile pic
lolacopacabana10-02-2025 20:56

<a:765355942921240597:879827586874744902>

user profile pic
lolacopacabana11-02-2025 22:17

🔥

user profile pic
lolacopacabana12-02-2025 22:03

🔥

user profile pic
lolacopacabana13-02-2025 16:12

💀

user profile pic
lolacopacabana13-02-2025 23:18

💀

user profile pic
lolacopacabana14-02-2025 02:02

💀

user profile pic
lolacopacabana14-02-2025 17:28

🔥

user profile pic
lolacopacabana15-02-2025 18:42

🔥

user profile pic
lolacopacabana15-02-2025 22:25

🔥

user profile pic
lolacopacabana16-02-2025 19:51

🔥

user profile pic
lolacopacabana17-02-2025 02:39

🔥

user profile pic
lolacopacabana17-02-2025 20:34

🔥

user profile pic
lolacopacabana18-02-2025 02:35

🔥

user profile pic
lolacopacabana18-02-2025 21:39

🔥

user profile pic
lolacopacabana19-02-2025 17:40

🔥

user profile pic
lolacopacabana19-02-2025 21:46

🔥

user profile pic
lolacopacabana20-02-2025 16:26

🔥

user profile pic
lolacopacabana20-02-2025 21:15

🔥

user profile pic
lolacopacabana21-02-2025 13:35

<a:dance:1341936279960424479>

user profile pic
lolacopacabana22-02-2025 16:06

🔥

user profile pic
lolacopacabana23-02-2025 19:08

🔥

user profile pic
lolacopacabana24-02-2025 13:39

🔥

user profile pic
lolacopacabana24-02-2025 20:15

🔥

user profile pic
lolacopacabana26-02-2025 21:13

🔥

user profile pic
lolacopacabana27-02-2025 02:36

🔥

user profile pic
lolacopacabana01-03-2025 02:23

🔥

user profile pic
lolacopacabana02-03-2025 19:31

🔥

user profile pic
lolacopacabana11-03-2025 02:44

🔥

Description

Dead Man’s Drink is a Project Zomboid server built for players seeking an immersive survival experience with both PvP and light roleplay. The world is unforgiving—PvP is enabled across the entire map, with no safe zones, forcing players to navigate trust, conflict, and survival. The server features custom mods, expanded maps, and handpicked QOL improvements to enhance realism and depth. Running on 128GB of RAM, it delivers smooth, lag-free performance with support for 32+ players. Global chat requires radios, adding an extra layer of immersion. While roleplay is encouraged, it’s not required—whether you forge alliances, trade, or go it alone, every decision shapes your survival. With community-driven updates, dynamic events, and an evolving world, this server offers the perfect blend of challenge, realism, and player-driven storytelling. Join today and carve out your place in the apocalypse. 🎮 Connect: steam://connect/51.161.119.64:28055

Today's activity
2💬
55🟢
2👥
13📞
Server overview
218👥Total members
1📅years old
14+Age requirement
server profile pic
Pine Creek Summer Camp 🏕
roleplayrpslice of lifesolcommunity
Description

We are an 18+ SFW roleplay server that mainly focuses on slice of life but we encourage our members to be as creative as they wish. Whether you want some adventure, angst, mystery or romance, we can do it all here.

We encourage creativity and enjoy a smattering of chaos from time to time - whether it be kids getting revenge against a mean staff member, escalating prank wars or accidentally burning down the boathouse with a misplaced firework.

The Pine Creek Summer Camp is an inclusive camp for children and teenagers from all walks of life - with special catering for those who are disabled, neurodivergent or in any way impoverished or troubled. With fun indoor and outdoor activities, all are welcome.

We have dozens of indoor and outdoor locations for 1x1 and small group roleplays as well as chatroom style channels you can use to talk as your characters to other characters. We use Tupperbox for added immersion and are happy to help beginners set up their characters and learn how to use it.

What we offer:
▫️ A welcoming, friendly community
▫️ Inclusive to everybody, regardless of race, religion, gender or sexuality
▫️ Dedicated staff who are passionate about roleplaying
▫️ OOC chat channels
▫️ Media, meme, and art channels

Today's activity
1💬
18🟢
1👥
0📞
Server overview
36👥Total members
8📅months old
18+Age requirement
server profile pic
Sex World
roleplayanimemangarpjjkanime rpanime roleplayjujutsu kaisenjjk rpmanga rpjujutsu kaisen roleplayanime mangajjk roleplayjujutsu kaisen rp
Description

𝐽𝑈𝐽𝑈𝑇𝑆𝑈 𝑆𝑂𝑈𝑆𝐸𝑁 — 𝑅𝐸𝑉𝐸𝐿𝐴𝑇𝐼𝑂𝑁𝑆
⇢ 𝗟𝗢𝗢𝗞𝗜𝗡𝗚 𝗙𝗢𝗥 𝗛𝗘𝗜𝗔𝗡 𝗘𝗥𝗔 𝗝𝗝𝗞 𝗥𝗣?

⇢ Wanna host missions? Wanna make it to the top? And with no stat system, no starting off at the weakest you could possibly be, and both the ability to grow IRP, as well as not having to worry about overbearing restrictions that mess up your character's narrative, while doing so? Well, you're at the right place! Now, on to the actual ad...

⇢ Time comes for us all, no doubt, but death 𝘥𝘰𝘦𝘴 wait.

⇢ The world of jujutsu will never be the same again, not after 𝙩𝙝𝙞𝙨... because 𝙚𝙫𝙚𝙧𝙮𝙩𝙝𝙞𝙣𝙜 is on the brink of changing forever. The turn of the first millenium draws near, and... so much has been lost. The age old war between man and curse has reached its peak, unspeakable evils have been unleashed, and no man, woman or child in Japan has been spared from the consequences. This is the height of the Heian era, what will you do?

Today's activity
1💬
20🟢
1👥
0📞
Server overview
65👥Total members
7📅months old
13+Age requirement
server profile pic
" Hold On " !! Detroit Become Human RP
dbhdetroit become humanroleplaydbh rpcommunitygamehangoutrp
Description

𖦹ㅤ ̼ ₊ㅤㅤLOADING. . . ㅤ ۪ ֹ

Detroit 2038. Technology has evolved to a point where human-like androids are everywhere. They speak, move and behave like human beings, but they are only machines serving humans. Play three distinct androids and see a world at the brink of chaos – perhaps our future - through their eyes

>﹒Main characters. Funny thing to call people. The world doesn't have main characters. They are just people that suffer and those who cause pain.

A free will. Yes, that's what is causing pain and chaos. There's no "choose" option anymore. There are just people and their will.

Think wisely. Nothing happens without a reason . . .

. . .
. . . . . .

> LOADING FINISHED

> PROCESS TO CONTINUE?
> YES > NO


⊹ ⠀࣪⠀ㅤㅤ ㅤ OUR OFFERT. . . ִ
> many free cc
> helpful crew including admins and mods
> chance to write your own storyline
> oc friendly
> safe community
> semi-lit / literate community
↷﹒⇆﹒

Today's activity
1💬
29🟢
1👥
0📞
Server overview
130👥Total members
1📅years old
13+Age requirement
server profile pic
ᴀꜱᴛʀᴀʟ ᴇxᴘʀᴇꜱꜱ
socialchillroleplaygameshoyoversehonkai: star rail
Description

A server for people to join and pretend to be their favorite characters from the game Honkai: Star Rail made by Hoyoverse!

Roleplay, hangout, play games, and just generally chill while involving yourself in Hsr and pretending to be your favorite characters! <3

Today's activity
0💬
27🟢
0👥
0📞
Server overview
32👥Total members
12📅days old
18+Age requirement
Description

Violent winds hissed around the borders of Empyrea. Intimidating avians stood guard with shimmering swords and heavy armour.
Suddenly, a voice rung out.
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
𝐍𝐨𝐧-𝐀𝐯𝐢𝐚𝐧 | "Stand on the wall for your picture." You walk over to the wall, the border patrol agent looking you up and down. A snap flashes before you. "Fill this out." You fill out your date of birth, full name, species, and give it back. After a moment, the following is handed to you and the barrier opens.
╔═══ .·:·.⚔︎✧ ✦ ✧𓂋.·:·. ═══╗
ᴇᴍᴘʏʀᴇᴀ ɪᴅ ᴄᴀʀᴅ
Identification NO: 13XXXX
DOB: M/D/Y
Issue Date: M/D/Y
Full Name: Jane Doe
Species: Species
Class: A0 - A4
Sect: -
ꜰᴏᴜɴᴅ? ʀᴇᴘᴏʀᴛ ᴛᴏ ᴇᴍᴘʏʀᴇᴀɴ ʙᴘ ᴏꜰꜰɪᴄᴇ.
╚═══ .·:·.⚔︎✧ ✦ ✧𓂋.·:·. ═══╝
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
𝐀𝐯𝐢𝐚𝐧 | "Identification card please." You hand over your ID card. The Border Patrol Agent glances at it, you, and nods. "Welcome back." The barrier opens.
╔═══ *.·:·.⚔︎✧ ✦ ✧𓂋.·:·.* ═══╗
ᴇᴍᴘʏʀᴇᴀ ɪᴅ ᴄᴀʀᴅ
Identification NO: 01XXXX | 02XXXX
DOB: M/D/Y
Issue Date: M/D/Y
Full Name: Jane Doe
Species: Avian
Class: A0 - A4 | DO -D4
Sect: Warrior | Noble
ꜰᴏᴜɴᴅ? ʀᴇᴘᴏʀᴛ ᴛᴏ ᴇᴍᴘʏʀᴇᴀɴ ʙᴘ ᴏꜰꜰɪᴄᴇ.
╚═══ *.·:·.⚔︎✧ ✦ ✧𓂋.·:·.* ═══╝
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
ʟɪᴋᴇ ᴡʜᴀᴛ ʏᴏᴜ ʀᴇᴀᴅ? ᴍᴏʀᴇ ɪɴꜰᴏʀᴍᴀᴛɪᴏɴ ᴀᴠᴀɪʟᴀʙʟᴇ ᴀᴛ: https://discord.gg/hw8thdvh9D
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
ꜱᴜᴍᴍᴀʀʏ: ʟᴀɴᴅ ᴏꜰ ᴇᴍᴘʏʀᴇᴀ ɪꜱ ᴀ ꜰʀᴇᴇꜰᴏʀᴍ ꜰᴀɴᴛᴀꜱʏ ꜱᴇʀᴠᴇʀ ʜᴏᴍᴇ ᴛᴏ ᴛʜᴇ ᴇᴍᴘʏʀᴇᴀɴꜱ. ᴡᴀʀʀɪᴏʀꜱ ᴀʀᴇ ᴇᴍᴘʏʀᴇᴀ'ꜱ ᴀʀᴍᴏᴜʀ, ᴅᴇꜰᴇɴᴅɪɴɢ ᴛʜᴇɪʀ ᴍᴏᴛʜᴇʀʟᴀɴᴅ ᴡɪᴛʜ ʙʀᴀᴠᴇʀʏ ᴀɴᴅ ʜᴏɴᴏʀ. ɴᴏʙʟᴇꜱ ᴀʀᴇ ᴇᴍᴘʏʀᴇᴀ'ꜱ ʙʟᴏᴏᴅ, ꜱᴜꜱᴛᴀɪɴɪɴɢ ᴛʜᴇɪʀ ᴄᴜʟᴛᴜʀᴇꜱ ꜱᴜʀᴠɪᴠᴀʟ. ᴅᴇᴠᴇʟᴏᴘ ᴡʜᴏ ʏᴏᴜ ʙᴇᴄᴏᴍᴇ ᴛʜʀᴏᴜɢʜ ʀᴏʟᴇᴘʟᴀʏ, ᴍɪꜱꜱɪᴏɴꜱ, ᴀɴᴅ ᴇᴠᴇɴᴛꜱ. ᴇxᴘʟᴏʀᴇ ʏᴏᴜʀ ᴘᴏᴛᴇɴᴛɪᴀʟ ᴛᴏᴅᴀʏ: ᴀᴠɪᴀɴ ᴏʀ ɴᴏɴ-ᴀᴠɪᴀɴ!

Today's activity
0💬
15🟢
0👥
0📞
Server overview
32👥Total members
3📅months old
17+Age requirement
server profile pic
FIM: World in Darkness
roleplayrpmlpzombieapolcaypsezombie-rp
user profile pic
somemfwholikeshalo11-01-2026 19:03

FIM: World in Darkness can be considered an AU, It takes place in a version of Equestria where the Elements of Harmony failed to conceal Nightmare Moon and only helped her plunge the world into chaos. It is a literate Roleplay server, and I would love to meet new people who would love to build on a story and create something great! I am currently the only admin on the server, but that could possibly change in the future. I am looking for a group of people, at a minimum, who would like to participate in a story. Tired of the usual MLP Roleplay server? Then give this server a try!

Description

FIM: World in Darkness can be considered an AU, It takes place in a version of Equestria where the Elements of Harmony failed to conceal Nightmare Moon and only helped her plunge the world into chaos. It is a literate Roleplay server, and I would love to meet new people who would love to build on a story and create something great! I am currently the only admin on the server, but that could possibly change in the future. I am looking for a group of people, at a minimum, who would like to participate in a story. Tired of the usual MLP Roleplay server? Then give this server a try!

Today's activity
0💬
5🟢
0👥
0📞
Server overview
6👥Total members
3📅months old
18+Age requirement
server profile pic
RythmRP | ERLC
roleplayrobloxerlc
Description

Projekt RythmRP został stworzony w celu wprowadzenia w końcu dobrego serwa na polskim community cały zespoł stara się go prowadzić jak najlepiej jak może mamy wiele zaawansowanych funkcji a nasi administratorzy są jednymi z najlepszych! Dzięki doświadczeniu Project Leaderów liczymy że serwer wypali!

Today's activity
0💬
14🟢
0👥
0📞
Server overview
31👥Total members
3📅months old
13+Age requirement
server profile pic
What should have never been. . . (18+ CRK RP)
roleplaycookie runcookie run rpcookie run kingdom
Description

Years have passed since the world was torn apart. The Ancient Heroes have returned but so did Dark Enchantress Cookie with the Beasts at her side. Reclaiming their original soul jams, it seemed as if this should have never happened… But a spark of light shines in the distance. Even when defeated, the Ancient Heroes still fought for what was right. Will you stand with the Ancient Heroes? Or join the Beasts in complete annihilation? Or perhaps… there is yet a third option. Decide the fate of Earthbread today and join us.

ABOUT
. •. ⋆ Cookie Run Kingdom/Ovenbreak AU
°。Literate to Novella RP
°。Lore-Driven Events & Plotlines
°。LGBT+ Friendly
. •. ⋆ 18+, ID Verified Community

Today's activity
0💬
18🟢
0👥
0📞
Server overview
34👥Total members
11📅months old
18+Age requirement
Description

A Hunger Games roleplay!

Today's activity
0💬
27🟢
0👥
0📞
Server overview
108👥Total members
4📅years old
16+Age requirement

210 servers found