Friends Discord servers

🔎 Search
🏷️ Tags
🔞 Age Requirement
📊 Sorting
👥 Server Size
📅 Server Age
🌍 Language
🎭 Vibes

105 servers found

The Anime Guild Discord server profile picture
The Anime Guild
animesocialcommunitychillmangafriendsactivegamesfunchatgaminghangoutfriendlysfwmemes
Description

Welcome to our server! This community was created by me and my friends purely for fun, a place where people can come together, relax, and enjoy good conversations without any pressure. What started as a small hangout has grown into a space where everyone is welcome, whether you’re here to talk, listen, or just chill. We love discussing games, anime, manga, and all kinds of other topics, but you don’t have to be an expert to fit in. Casual chats, deep discussions, memes, recommendations, and random moments are all part of the experience here. The goal is simple: have fun, be respectful, and enjoy your time. This server is meant to be a comfortable and friendly environment where you can be yourself, meet new people, and unwind after a long day. Whether you’re gaming, watching anime, reading manga, or just looking for a place to relax and talk, you’ll always find a spot here. Join us, take it easy, and make yourself at home, we’re glad to have you.

Today's activity
275
12
0
Server overview
263Total members
8months old
18Age requirement
Description

Welcome to the perfect place to make discord friends, share laughs, and build real friendships in a fun and friendly community! 1# Friends Discord Server.

Today's activity
51.3k
1.5k
187
Server overview
157.9kTotal members
6years old
13Age requirement
Stand Strong India Discord server profile picture
Stand Strong India
indiaindianpakistanusalovepeacesupportawarenessfriendschattinghangout
user profile pic
sussybakah15-09-2024 07:17

Hello

Description

Join Our Anti-Racism Campaign Server! Welcome to a vibrant and inclusive community dedicated to combating racism and promoting equality. Our mission is to provide a safe space for individuals to: - Report Hate: Use our dedicated channels to report any incidents of racism or hate speech. - Support Each Other: Share experiences and find comfort in our support room. - Educational Resources: Access guides, intervention tips, and educational videos to help you take action and spread awareness. - Celebrate Cultural Pride: Learn about and celebrate the rich diversity of cultures from around the world. - Stay Informed: Keep up with the latest news, updates, and server announcements. Whether you're looking to take action, seek support, or just learn more about fighting racism, you'll find a welcoming and active community here. Moderators are always on hand to ensure a respectful and positive atmosphere.

Today's activity
10
4
0
Server overview
194Total members
1years old
14Age requirement
Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang Discord server profile picture
Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang
communitysocialchillgamingroleplaygameshangoutfriendsfunfriendlychatmusicactiveminecraftrobloxrpfortnitegiveawaysprogrammingvalorantenglishchattingyoutubenitrolanguagediscordlearningminecraft-servergiveawayminecraft-javaespañolpcpokemongaming-communitywelcomingsupportvoice chatserveractive-communitytradingrobuxcryptospanishfrencheuropepvpnewsgamerspromotradehacksamericacryptosignalsbitcoindaytraderkemeticgermangermanymetin2yangbuym2tradecentermetin2tradermetin2pvpmetin2wonbuymetin2yangbuysmetin2yangbuygermaniametin2yangbuyiberiametin2metin2tradecenterm2trademetin2yangbuyeuropemetin2yangbuyitaliamt2trademetin2tradeusdtmetin2yangmetin2germaniawonbuymetin2teutoniawonbuymetin2teutoniayangbuymetin2teutoniayangkaufenmetin2teutoniawonkaufenmetin2 europe yang buymetin2 europe yangmetin2 italia yang buymetin2 iberia yang buymetin2 tigerghotmetin2 tigerghost yang buymetin2 tigerghost won buymetin2 tigerghost yang kaufenmetin2 tigerghost won kaufenanimemetin2 romania yang buymetin2 romania won buymetin2 ruby kirin won buymetin2 ruby kirin yang buymetin2tr yang satinalmetin2tr won satinalmetin2tr yangmetin2pvp yang satinalmetin2pvp yang buymetin2pvp won buy
user profile pic
metin2.yang13-05-2026 00:53

hi

user profile pic
guardwon13-05-2026 00:56

Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang! Metin2 Global/Official Won/YANG FAST DELIVERY Safe Trade Discord Add : metin2yang 👽-;----FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #Metin2 won buy #Metin2 won farming #buy Metin2 won #Metin2 won guide #how to buy won #Metin2 won tips #Metin2 won making #Metin2 won selling #cheap Metin2 won #Metin2 won tutorial #Metin2 won scams #Metin2 won market #Metin2 won tricks #Metin2 won 2025 #Metin2 won s

Description

Metin2TradeCenter Group 2027 Won/YANG FAST DELIVERY Safe TradeDiscord Add : metin2yang 👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #wonbuy #wonsell #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #metin2yangbuy #dragoncoins #Metin2yangkaufen #sell #metin2tradecenter #buy #tradecenter Metin2 Global/Official Won/YANG FAST DELIVERY Safe TradeDiscord Add : metin2yang👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #Metin2 won buy #Metin2 won farming #buy Metin2 won #Metin2 won guide #how to buy won #Metin2 won tips #Metin2 won making #Metin2 won selling #cheap Metin2 won #Metin2 won tutorial #Metin2 won scams #Metin2 won market #Metin2 won tricks #Metin2 won 2025 #Metin2 won strategies #Metin2 won farming guide #Metin2 won leveling #best Metin2 won #Metin2 won offline shop #Metin2 won alchemy #RubyChimera #RubyKirin #Azrael #Tigerghost #Metin2pvp #Metin2pvm #Metin2p #Metin2.de #Metin2.ro #Metin2.en #Metin2it #Metin2.ru #Metin2.us #Metin2.uk #Metin2.pl #Metin2.cz #Metin2.hu #Metin2.ar #Metin2.ae #Metin2.ea #Metin2.es #Metin2.pt #Metin2.gb #Metin2.ar #Metin2.co #Metin2.co #Metin2.mc #Metin2.mx #Metin2.pe #Metin2.fr #Metin2.magyar #Metin2.br #Metin2.tr #Metin2tr #Metin2.germania #Metin2Teutonia #Metin2Europe #Metin2.eu #Metin2Marmara #Metin2.west #metin2west #Metin2Dandanakan #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter

Discord Add : metin2yang👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy Metin2Tradecenter Private-gameforge-official Won-YANG discord: metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #dragoncoin #metin2tradecenter #tradecenter #wonkuanfen #tigerghost #tigerghostwonbuy #mt2tradecenter #metin2

Today's activity
256
43
2
Server overview
6.2kTotal members
5months old
18Age requirement
Shokubeni: Hate.FM Discord server profile picture
Shokubeni: Hate.FM
chillsocialmusicfriendstoxicmoviesfunanime
user profile pic
ruinedcrimson08-10-2023 21:19

erm

Description

Shokubeni's a cool place for cool cats, y'dig? Join or forever be left in the dust.

14+
All genres welcome
Regular music and movie nights
Small but active roster
Open to suggestions
Low level moderation


[Written by NERD]

Today's activity
132
15
0
Server overview
90Total members
3years old
16Age requirement
Femboy Order ・Femboy Tag ・LGBTQ・Femboys・ Gay・Furry・Trans・Roblox・Warthunder・Gay Tag・Furries Discord server profile picture
Femboy Order ・Femboy Tag ・LGBTQ・Femboys・ Gay・Furry・Trans・Roblox・Warthunder・Gay Tag・Furries
communitysocialgamingfriendsfurrylgbtgaylgbtqfemboytransmake friendsfemboysfurries#community
Description

Femboy order is discords fastest growing and most active LGBTQ+, Furry & Femboy Community! If your looking for a place to feel included, seen and welcomed while having fun you've found it! :3

Today's activity
96.9k
1.9k
345
Server overview
35.9kTotal members
2years old
14Age requirement
Transformation Talk Discord server profile picture
Transformation Talk
furrytransformationfriendshangout
Description

we're a new server dedicated to all kindsa transformations

Today's activity
5.4k
35
0
Server overview
281Total members
2years old
13Age requirement
The Lords Of Geek 🔞 Discord server profile picture
The Lords Of Geek 🔞
socialcommunitychillgaminghangoutanimefriendsfunartvcmusicactivememesmangamoviesevents18+marvelmultifandomstreamingfriendshipxboxbookstechnologyfandomdcsci-fiplaystationstar warsadult onlyentertainmentcomicsroleplayingnintendopc gamingcontent creatorpodcastsspider-manconsole gamingdiscussionsadultgamerstelevisiontv showspop culturenerd culturetabletop gaminggeek cultureenglish
user profile pic
renegadeoperative07-06-2026 22:03

⚡ Nerds rule the world. Gaming • Anime • Comics • Movies • Podcasts • Events • Community Chaos | Join Lords of Geek today.

Description

The Infinite Ammo Syndicate - Lords Of Geek is a community Discord which covers everything within variety nerd culture. We discuss gaming, anime, comics, movies, and everything in between. You know what they say? Nerds rule the world.

☞︎𝐖𝐡𝐚𝐭 𝐰𝐞 𝐨𝐟𝐟𝐞𝐫☜︎
--------------------------------------------------------------------
🧧▸ An 18+ geek community for fans of gaming, anime, comics, and pop culture.
🧧▸ A gaming hub for co-op, multiplayer, party games, and finding other players.
🧧▸ Active chats, voice chats, and daily conversations across geek culture.
🧧▸ Anime, movie, television, and watch party discussions.
🧧▸ A multifandom hub covering gaming, anime, comics, sci-fi, fantasy, and pop culture.
🧧▸ A place to share fan art, cosplay, writing, and other fandom creations.
🧧▸ Events, podcasts, community spotlights, and other geek-centric activities.
🧧▸ Memes, banter, fun, and the occasional controlled dose of community chaos.

Today's activity
4.0k
40
11
Server overview
377Total members
10years old
18Age requirement
my server Discord server profile picture
my server
socialcommunityfriendsphilosophyjazzgamedevprogramminggamingmusic
user profile pic
4onen14-09-2023 23:32

check what?

user profile pic
honeycide14-09-2023 23:33

GLOMP

user profile pic
licorice_tea14-09-2023 23:34

Vaporeon copypasta Hey guys, did you know that in terms of male human and female Pokémon breeding, Vaporeon is the most compatible Pokémon for humans? Not only are they in the field egg group, which is mostly comprised of mammals, Vaporeon are an average of 3”03’ tall and 63.9 pounds, this means they’re large enough to be able handle human dicks, and with their impressive Base Stats for HP and access to Acid Armor, you can be rough with one. Due to their mostly water based biology, there’s no doubt in my mind that an aroused Vaporeon would be incredibly wet, so wet that you could easily have sex with one for hours without getting sore. They can also learn the moves Attract, Baby-Doll Eyes, Captivate, Charm, and Tail Whip, along with not having fur to hide nipples, so it’d be incredibly easy for one to get you in the mood. With their abilities Water Absorb and Hydration, they can easily recover from fatigue with enough water. No other Pokémon comes close to this level of compatibility. Also, fun fact, if you pull out enough, you can make your Vaporeon turn white. Vaporeon is literally built for human dick. Ungodly defense stat+high HP pool+Acid Armor means it can take cock all day, all shapes and sizes and still come for more

user profile pic
Maximilian I14-09-2023 23:35

this server has cats and kittens and things! wild!

user profile pic
renjirojine14-09-2023 23:36

Love this place!

user profile pic
Maximilian I14-09-2023 23:41

good music

user profile pic
honeycide14-09-2023 23:43

I like cake :3

user profile pic
Maximilian I14-09-2023 23:46

serverhunt is a perfectly balanced game with no bugs or exploits \:P

user profile pic
Maximilian I14-09-2023 23:46

this place has cake, if you join a kitten will come an give you free came

user profile pic
Maximilian I14-09-2023 23:47

*cake

user profile pic
Maximilian I14-09-2023 23:47

0/10, too many cute kittens

user profile pic
honeycide14-09-2023 23:55

I’m a silly goose!

user profile pic
Maximilian I15-09-2023 00:00

cats!!!!!!

user profile pic
licorice_tea15-09-2023 00:07

I HAVE COME TO MAKE AN ANNOUNCEMENT!

user profile pic
vga0xb800015-09-2023 05:02

hii

user profile pic
pannoniae22-09-2023 20:38

There are free steaks and fries for everyone!

user profile pic
pannoniae23-09-2023 19:25

0xb is very nice :)

user profile pic
pannoniae14-09-2023 23:30

Can I recommend my own server? If yes, I do ;)

user profile pic
pannoniae14-09-2023 23:33

What if I do it again?

user profile pic
pannoniae15-09-2023 00:00

serverhunt is a perfectly balanced game with no bugs or exploits :P

user profile pic
pannoniae09-08-2024 00:52

test

Description

This is just my server. :) We don't judge you whether you are a dog or a three-legged alien on the internet, come on in! What we have: • my amazing custom-coded musicbot • homemade blockgame development :) • lovely people • cutting-edge research in community building • brain teasing • freedom of expression, no arbitrary or unfair moderators • quite a few people interested in jazz • a lovely zoo for people who can't behave.... oh and we have probably the most complete Fats Waller collection on the internet :)

Today's activity
5
5
0
Server overview
1.2kTotal members
5years old
13Age requirement
SoCal Locals Discord server profile picture
SoCal Locals
gaminghangoutfriendssan diegolos-angelessocalmeetupsriversidecalifornia
Description

This server was created to connect people in the SoCal region and beyond! This server offers: - Area-focused Community - Frequent Meetups - 18+ Members Only - Active Chat - Lively VCs - Fun Bots - THIS IS NOT a dating server

Today's activity
3.2k
103
19
Server overview
891Total members
8months old
18Age requirement
tohuu Discord server profile picture
tohuu
hangoutfriendssillybrainrotpjsk
Description

tohuu

Today's activity
247
13
0
Server overview
232Total members
1years old
13Age requirement
Tyvid Discord server profile picture
Tyvid
18+friendsgamessocialchillactivehangoutfunvc
Description

low mod, frequent vc, cool people. be weird, make friends, stay a while, and don't be boring. 18+ only. toxic server—if u can't handle the heat, get out of the kitchen. touch grass tomorrow. join :3

Today's activity
1.3k
24
7
Server overview
85Total members
1years old
18Age requirement
The Russian Language Discord server profile picture
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
956
71
29
Server overview
6.8kTotal members
5years old
13Age requirement
The Void Of Nightmares 🔞 Discord server profile picture
The Void Of Nightmares 🔞
communitygaminggameshangoutfriendsfunartevents18+horrorlgbtlgbtqstreamingloremovie nightswitchcraftzombiesadult onlyparanormalpodcastsdiscussionssurvivalhorrorcreaturemultiplayerwatchpartytrue crimecontent creatorshorror lorehorror fanshorror mangasurvival horrorcapcomspookygothdead spaceindie horrorocculthalloweenhorror gamesevil withinhorror communityco-op gamesdino crisishorror moviesresident evilsilent hillhorror animeenglish
user profile pic
renegadeoperative07-06-2026 22:02

💀 Horror without limits. Movies • Games • Analog Horror • Urban Legends • Watch Parties • Podcasts • Halloween Events | Welcome to The Void of Nightmares.

Description

The Infinite Ammo Syndicate - The Void Of Nightmares is a community based Discord that covers all things related to the horror medium. In the deep recesses of your mind, no one can hear you scream. It's Halloween all day, every day.

☞︎𝐖𝐡𝐚𝐭 𝐰𝐞 𝐨𝐟𝐟𝐞𝐫☜︎

🎃▸ An 18+ horror community for adults who love all things macabre.
🎃▸ Horror without limits: movies, games, watch parties, and discussions.
🎃▸ Paranormal, occult, literature, and folklore discussions.
🎃▸ Analog horror, urban legends, and the unexplained.
🎃▸ A low-pressure atmosphere — join at your own pace.
🎃▸ Events, voice chats, podcasts, and community spotlights.
🎃▸ Halloween celebrations, seasonal horror events, and spooky festivities year-round.

Today's activity
1.8k
33
9
Server overview
782Total members
6years old
18Age requirement
Pink Heaven♡ Discord server profile picture
Pink Heaven♡
communitygamingfriendsrobloxmovieseventshorror13+
Description

♡‧₊˚Welcome to Pink Heaven‧₊˚♡
୨ ╭・─・─・─・─・─・─・─・─・─ ・୨୧ ˎˊ˗
♡┊‧₊˚ a wholesome & SFW community !
♡┊‧₊˚ a cute pink aesthetic layout
♡┊‧₊˚ voice chats & events
♡┊‧₊˚ horror, movies, + more
♡┊‧₊˚ gaming (Roblox, etc.)
୨ ╰・─・─・─・─・─・─・─・─・─・୨୧ ˎˊ˗
https://discord.gg/aHk8AxDEDJ

Today's activity
881
19
2
Server overview
1.6kTotal members
3years old
13Age requirement
The Mitten 21+ Discord server profile picture
The Mitten 21+
league of legendsmichiganmidwestanimecommunityfriendsgamingsocialchillhangout
Description

Server name: The Mitten 21+ Server tags: league of legends, michigan, midwest, anime, community, friends, gaming, social, chill, hangout Server NSFW: False Server minimum age: 21 Server description: 𝓣𝓱𝓮 𝓜𝓲𝓽𝓽𝓮𝓷 21+ 𝖠 21+ 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 𝗐𝗁𝖾𝗋𝖾 𝖺𝖽𝗎𝗅𝗍𝗌 𝖿𝗋𝗈𝗆 𝖬𝗂𝖼𝗁𝗂𝗀𝖺𝗇 (𝖺𝗇𝖽 𝖻𝖾𝗒𝗈𝗇𝖽) 𝖼𝖺𝗇 𝖼𝗈𝗆𝖾 𝗍𝗈𝗀𝖾𝗍𝗁𝖾𝗋 𝗍𝗈 𝖿𝗂𝗇𝖽 𝖿𝗋𝗂𝖾𝗇𝖽𝗌, 𝗌𝗁𝖺𝗋𝖾 𝗂𝗇𝗍𝖾𝗋𝖾𝗌𝗍𝗌, 𝖺𝗇𝖽 𝖼𝗁𝖺𝗍! 𝖶𝖾 𝗅𝗈𝗏𝖾 𝗀𝖺𝗆𝗂𝗇𝗀 𝖺𝗇𝖽 𝖺𝗇𝗂𝗆𝖾 𝗍𝗈𝗈—𝗃𝗈𝗂𝗇 𝗎𝗌 𝖿𝗈𝗋 𝖫𝖾𝖺𝗀𝗎𝖾 𝗈𝖿 𝖫𝖾𝗀𝖾𝗇𝖽𝗌, 𝖥𝗈𝗋𝗍𝗇𝗂𝗍𝖾, 𝖬𝗂𝗇𝖾𝖼𝗋𝖺𝖿𝗍, 𝗈𝗋 𝗁𝖺𝗇𝗀 𝗈𝗎𝗍 𝖺𝗇𝖽 𝖼𝗁𝖺𝗍 𝖺𝖻𝗈𝗎𝗍 𝗒𝗈𝗎𝗋 𝖿𝖺𝗏𝗈𝗋𝗂𝗍𝖾 𝖺𝗇𝗂𝗆𝖾 𝗌𝗁𝗈𝗐𝗌! 𝖶𝗂𝗍𝗁 𝖾𝗏𝖾𝗇𝗍𝗌, 𝗀𝖺𝗆𝖾 𝗇𝗂𝗀𝗁𝗍𝗌, 𝖺𝗇𝖽 𝗆𝖾𝖺𝗇𝗂𝗇𝗀𝖿𝗎𝗅 𝖼𝗈𝗇𝗏𝖾𝗋𝗌𝖺𝗍𝗂𝗈𝗇𝗌, 𝗍𝗁𝖾𝗋𝖾’𝗌 𝖺𝗅𝗐𝖺𝗒𝗌 𝗌𝗈𝗆𝖾𝗍𝗁𝗂𝗇𝗀 𝗀𝗈𝗂𝗇𝗀 𝗈𝗇. 𝖢𝗈𝗆𝖾 𝖻𝖾 𝗉𝖺𝗋𝗍 𝗈𝖿 𝗍𝗁𝖾 𝖿𝗎𝗇! 𝓱𝓸𝓹𝓮 𝓽𝓸 𝓼𝓮𝓮 𝔂𝓸𝓾 𝓱𝓮𝓻𝓮! Server invite link: https://discord.gg/bfkzDs4AuN Server invite channel: <#1291387135454216192> Server hidden status: Visible (not hidden)

Today's activity
330
26
0
Server overview
337Total members
1years old
21Age requirement
lillium Discord server profile picture
lillium
friendschillemojispfpanimehangoutmangateenenglishsemi-toxic
Description

૮ • ﻌ - ა 𝐢𝐬 𝐮𝐬𝐮𝐚𝐥𝐥𝐲 𝐚 𝐟𝐫𝐢𝐞𝐧𝐝𝐥𝐲 𝐛𝐮𝐭 𝐬𝐨𝐦𝐞𝐭𝐢𝐦𝐞𝐬 𝐬𝐞𝐦𝐢-𝐭𝐨𝐱𝐢𝐜 𝐬𝐞𝐫𝐯𝐞𝐫 𝐭𝐡𝐚𝐭 𝐢𝐬 𝟏𝟔+! 𝐖𝐞 𝐡𝐚𝐯𝐞 𝐨𝐯𝐞𝐫 𝟏𝟐𝟔 𝐜𝐨𝐥𝐨𝐫 𝐞𝐦𝐨𝐣𝐢𝐬/𝐠𝐢𝐟𝐬 𝐭𝐡𝐚𝐭 𝐚𝐫𝐞 𝐜𝐨𝐥𝐨𝐫 𝐜𝐨𝐨𝐫𝐝𝐢𝐧𝐚𝐭𝐞𝐝, 𝐩𝐫𝐨𝐟𝐢𝐥𝐞 𝐩𝐢𝐜𝐭𝐮𝐫𝐞 𝐜𝐡𝐚𝐧𝐧𝐞𝐥𝐬, 𝐯𝐞𝐧𝐭𝐢𝐧𝐠 𝐜𝐡𝐚𝐧𝐧𝐞𝐥𝐬, 𝐐𝐎𝐓𝐃 𝐚𝐧𝐝 𝐦𝐨𝐫𝐞! 𝐌𝐚𝐧𝐲 𝐛𝐨𝐭𝐬 𝐬𝐮𝐜𝐡 𝐚𝐬 𝐏𝐨𝐤𝐞𝐭𝐰𝐨, 𝐌𝐮𝐝𝐚𝐞, 𝐋𝐚𝐰𝐥𝐢𝐞𝐭, 𝐚𝐧𝐝 𝐔𝐬𝐞𝐫𝐩𝐡𝐨𝐧𝐞. 𝐏𝐥𝐞𝐚𝐬𝐞 𝐣𝐨𝐢𝐧 𝐚𝐧𝐝 𝐠𝐢𝐯𝐞 𝐮𝐬 𝐟𝐞𝐞𝐝𝐛𝐚𝐜𝐤! 𝐎𝐮𝐫 𝐫𝐮𝐥𝐞𝐬 𝐚𝐫𝐞 𝐥𝐢𝐬𝐭𝐞𝐝 𝐡𝐞𝐫𝐞: 𝐭𝐡𝐢𝐬 𝐢𝐬 𝐚 𝟏𝟔 𝐲𝐞𝐚𝐫 𝐨𝐥𝐝 𝐚𝐧𝐝 𝐨𝐥𝐝𝐞𝐫 𝐬𝐞𝐫𝐯𝐞𝐫 ,𝐞𝐧𝐠𝐥𝐢𝐬𝐡 𝐨𝐧𝐥𝐲, 𝐧𝐨 𝐧𝐬𝐟𝐰/𝐠𝐨𝐫𝐞, 𝐰𝐞 𝐚𝐫𝐞 𝐬𝐞𝐦𝐢-𝐭𝐨𝐱𝐢𝐜 𝐛𝐮𝐭 𝐝𝐨𝐧'𝐭 𝐨𝐯𝐞𝐫𝐬𝐭𝐞𝐩 𝐛𝐨𝐮𝐧𝐝𝐚𝐫𝐢𝐞𝐬, 𝐧𝐨 𝐫𝐚𝐩𝐞, 𝐝𝐨𝐱𝐱𝐢𝐧𝐠 𝐨𝐫 𝐞𝐭𝐜. 𝐣𝐨𝐤𝐞𝐬, 𝐧𝐨 𝐜𝐨𝐧𝐭𝐫𝐨𝐯𝐞𝐫𝐬𝐲 𝐨𝐫 𝐝𝐢𝐬𝐜𝐫𝐢𝐦𝐢𝐧𝐚𝐭𝐢𝐨𝐧.

Today's activity
26
5
0
Server overview
78Total members
1years old
16Age requirement
Brays DBD Lounge Discord server profile picture
Brays DBD Lounge
gamesgamingdbdfriendssocial
Description

Fun friendly and safe environment to make friends to play dbd with

Today's activity
720
23
0
Server overview
255Total members
3months old
13Age requirement
Vibe Lounge Discord server profile picture
Vibe Lounge
socialfriends25+30+vc
Description

Looking for an easygoing and active community? Can't sleep and looking for a place to hangout? If you like supportive, fun and engaging environments, Vibe Lounge is for you! In addition to being a place to share your hobbies and passions, we offer:

☕ a mature environment for chatting and playing games (25+)
🗣️ active voice-chat
🧩 collaborative and competitive games (Co-ordle, UNO, Area, Counting, Gartic, Minecraft, etc.)
🎮 game nights for group games and banter (Cards Against Humanity, JackBox, Fall Guys, etc.)
😆 memes
❓ daily polls and questions
🌳 watering tree
🎁 free giveaways and community events
🙂 positive and welcoming staff

We look forward to showing you around and getting to know you!

Today's activity
6.8k
56
19
Server overview
196Total members
1years old
25Age requirement
𝗗𝟰 Discord server profile picture
𝗗𝟰
communitysocialchillgamingroleplaygameshangoutanimefriendsfunfriendlyartchatmusicactiverobloxvcsfwminecraftlgbtq+memesmangarpeventspoliticsvaloranthorrorenglishnon-toxicprogramminganime rpaireading13+egirlslgbtqcatslgbtq friendlyteenactive-communitysportstechnologyfootballvoice chatnontoxicgamersbooksmusic producersegirlbookclubcutegtaadultsvoice-chatemojiartsmusicianteensgoofyweedactive-voicechatsmoking420gamerapexteen-friendlyhouse of the dragonanime rpgvcsemojisfun factsgame nightsvaporwavetechnicallgbtq+ friendlygame-devraidsno toxicitygta vdevelopershang outpersonal developmentmusic botsemoclassical musiceboystomb-raidersoccerstorytechlgbt friendlysocial community vc fun friendlyraidingskateboardinggamer-girlsweebnukevapingeboyd4gamer-girlskatingscooteractive voice chatraiderssk8stonervaporprogrammersskatergamergirlpartnershippartnershipspartnerpvppcskateskateboardskawritingmoviemovie nightmoviesmovie nightsfilm
Description

𝗗𝟰 𝗶𝘀 𝘁𝗮𝗶𝗹𝗼𝗿𝗲𝗱 𝘁𝗼 𝗮𝗹𝗹 𝗽𝗲𝗼𝗽𝗹𝗲 𝘄𝗵𝗼 𝗷𝗼𝗶𝗻.
● sғᴡ → ᴀʀᴛ
● ᴛᴇᴄʜ → ᴀɴɪᴍᴇ
● ᴍᴜsɪᴄ → ᴍᴇᴍᴇs
● ᴇᴠᴇɴᴛs → sᴏᴄɪᴀʟ
● ᴀᴄᴛɪᴠᴇ → ᴠᴀᴘᴇʀs
● ᴇ-ʙᴏʏs → ʜɪᴘᴘɪᴇs
● ɢᴀᴍɪɴɢ → ᴇ-ɢɪʀʟs
● sᴋᴀᴛᴇʀs → sᴛᴏɴᴇʀs
● ᴇǫᴜᴀʟɪᴛʏ → ᴀᴛʜʟᴇᴛᴇs
● ᴍᴜsɪᴄɪᴀɴs → sᴛʀᴇᴀᴍɪɴɢ
● ʀᴀᴘ-ʙᴀᴛᴛʟᴇs→ ɴᴏɴ-sᴛᴏɴᴇʀs
● ᴘʀᴏɢʀᴀᴍᴍɪɴɢ → ᴄʏʙᴇʀ-sᴇᴄᴜʀɪᴛʏ
● ᴄᴀᴛᴄʜɪɴɢ-ᴘᴇᴅᴏs → ғʀᴇᴇ-ᴇxᴘʀᴇssɪᴏɴ
● ᴀɴᴛɪ-ᴄᴏʀʀᴜᴘᴛɪᴏɴ → ᴍᴜsɪᴄ-ᴘʀᴏᴅᴜᴄᴇʀs
● ᴄᴏɴᴛᴇɴᴛ -ᴄʀᴇᴀᴛᴏʀs → ᴘᴏᴇᴛʀʏ ᴀɴ ǫᴜᴏᴛᴇs
𝗧𝗵𝗲 𝗽𝗲𝗿𝗳𝗲𝗰𝘁 𝗽𝗹𝗮𝗰𝗲 𝗳𝗼𝗿 𝗺𝗲𝗲𝘁𝗶𝗻𝗴 𝗻𝗲𝘄 𝗽𝗲𝗼𝗽𝗹𝗲 𝗲𝘃𝗲𝗿𝘆𝗱𝗮𝘆.

NON-TOXIC

Today's activity
516
46
23
Server overview
756Total members
1years old
13Age requirement
the pod Discord server profile picture
the pod
animekpopsocialcommunitygamingfunfriendschat
user profile pic
n0lanv11-09-2024 19:31

join?

Description

ᡣ𐭩 𝘞𝘦𝘭𝘤𝘰𝘮𝘦 𝘵𝘰 𝘊𝘭𝘰𝘶𝘥𝘺'𝘴 𝘈𝘱𝘱𝘭𝘦𝘴 ! ᡣ𐭩
𝘞𝘦 𝘢𝘳𝘦 𝘢 𝘧𝘶𝘯, 𝘴𝘶𝘱𝘱𝘰𝘳𝘵𝘪𝘷𝘦, 𝘢𝘯𝘥 𝘤𝘭𝘰𝘴𝘦 𝘤𝘰𝘮𝘮𝘶𝘯𝘪𝘵𝘺 𝘵𝘩𝘢𝘵 𝘴𝘩𝘢𝘳𝘦𝘴 𝘮𝘶𝘭𝘵𝘪𝘱𝘭𝘦 𝘪𝘯𝘵𝘦𝘳𝘦𝘴𝘵𝘴! 𝘞𝘦 𝘸𝘦𝘭𝘤𝘰𝘮𝘦 𝘦𝘷𝘦𝘳𝘺𝘰𝘯𝘦! 𝘍𝘳𝘰𝘮 𝘨𝘢𝘮𝘦𝘳𝘴, 𝘵𝘰 𝘬𝘱𝘰𝘱 𝘧𝘢𝘯𝘴, 𝘵𝘰 𝘢𝘯𝘪𝘮𝘦 𝘧𝘢𝘯𝘴. 𝘞𝘦 𝘩𝘢𝘷𝘦 𝘮𝘶𝘭𝘵𝘪𝘱𝘭𝘦 𝘝𝘊 𝘤𝘩𝘢𝘯𝘯𝘦𝘭𝘴, 𝘴𝘱𝘢𝘤𝘦𝘴 𝘧𝘰𝘳 𝘵𝘩𝘦 𝘨𝘪𝘳𝘭s *and boys* 𝘰𝘯𝘭𝘺, 𝘤𝘶𝘳𝘴𝘦𝘥 𝘪𝘮𝘢𝘨𝘦 𝘤𝘩𝘢𝘯𝘯𝘦𝘭𝘴, 𝘢𝘯𝘥 𝘴𝘰 𝘮𝘶𝘤𝘩 𝘮𝘰𝘳𝘦! 𝘞𝘦 𝘢𝘳𝘦 𝘢𝘤𝘵𝘪𝘷𝘦𝘭𝘺 𝘵𝘳𝘺𝘪𝘯𝘨 𝘵𝘰 𝘦𝘹𝘱𝘢𝘯𝘥 𝘰𝘶𝘳 𝘤𝘰𝘮𝘮𝘶𝘯𝘪𝘵𝘺 𝘴𝘰 𝘱𝘭𝘦𝘢𝘴𝘦 𝘧𝘦𝘦𝘭 𝘧𝘳𝘦𝘦 𝘵𝘰 𝘫𝘰𝘪𝘯 𝘶𝘴, 𝘢𝘯𝘥 𝘢𝘥𝘥 𝘵𝘰 𝘰𝘶𝘳 𝘧𝘢𝘮𝘪𝘭𝘺! 𝘛𝘩𝘪𝘴 𝘐𝘚 𝘢 20+ 𝘴𝘦𝘳𝘷𝘦𝘳, 𝘴𝘰 𝘱𝘭𝘦𝘢𝘴𝘦 𝘣𝘦 20 𝘰𝘳 𝘢𝘣𝘰𝘷𝘦 𝘸𝘩𝘦𝘯 𝘫𝘰𝘪𝘯𝘪𝘯𝘨 𝘵𝘰 𝘦𝘯𝘴𝘶𝘳𝘦 𝘢 𝘴𝘢𝘧𝘦 𝘴𝘱𝘢𝘤𝘦 𝘧𝘰𝘳 𝘦𝘷𝘦𝘳𝘺𝘰𝘯𝘦.

Today's activity
903
34
5
Server overview
222Total members
1years old
20Age requirement
Black Crow || クロ カラス Discord server profile picture
Black Crow || クロ カラス
aipsychologyphilosophypartnershipfriends
Description

🌑 『 𝐊𝐔𝐑𝐎 𝐊𝐀𝐑𝐀𝐒𝐔 II クロカラス 』 🌑

Today's activity
367
25
4
Server overview
198Total members
4months old
13Age requirement
cult of the dead rabbit Discord server profile picture
cult of the dead rabbit
communitysocialchillgamesfriendsmoviesvoice chat21+contestsvc
Description

The Cult of the Dead Rabbit is an exclusive adult (21+) social community where fun and respect collide in a toxic-free environment! We are not your typical voice chat community, and we take pride in our 333 member limit to ensure a tight-knit, intimate experience.
*All applicants are subject to a minimum of a 14 day probationary period.

-8 Membership Openings
-5 Years and Running
-130,000 VC Hours
-333 Members

🫴Join here: https://discord.gg/jointhecult
🔗 Website: https://cultofthedeadrabbit.com

🐇 **ACTIVE SAFE & FUN VOICE CHATS**
Our community features a culture of chill and safe socializing where you can unwind, meet like-minded people, and engage in active 24h voice chats. Our time zone-balanced membership means you'll always find someone to chat with, no matter where you are in the world.

🐇 **VERIFIED CULT MEMBERSHIP**
We take our membership screening seriously, which is why all users go through a short voice interview/verification process before joining our community. We want to ensure that everyone who joins shares our values of respect, kindness, and inclusivity. ID is not required for verification.

🐇 **CULTURE OF THE DEAD RABBIT**
At the Cult of the Dead Rabbit, we keep things light and enjoyable, so you won't find any in-depth political, religious, sexual or racial discussions. Instead, we focus on community events, Discord Nitro draws, and our very own Cult Swag Shop, where you can show off your love for the cult.

🐇 **PRIVACY & SAFETY**
Want to know the best part? What happens in the cult stays in the cult! So you can let loose and be yourself without any fear of judgment. Don't believe us? Check out our member reviews or visit our website to learn more about the Cult of the Dead Rabbit.

Come join us, and let's have some fun!

Today's activity
220
50
57
Server overview
584Total members
5years old
21Age requirement
Active VC Server • Chill • Hangout • Socialize • Voice Chat • Anime • Call Discord server profile picture
Active VC Server • Chill • Hangout • Socialize • Voice Chat • Anime • Call
communitysocialchillgaminghangoutfriendschatfriendlyactivevcanimefunactivevcrobloxsfwmemesmanga
Description

Welcome to the #1 spot to make new friends! We are a super active, 24/7 SFW community designed to connect our members through packed voice chat lobbies and engaging text conversations. Our goal is to provide a friendly, wholesome experience where you can chill, game, and socialize with a diverse group of people.

Active Community: Enjoy constant activity with 24/7 voice chats, lively text channels, and a welcoming space for egirls, eboys, and everyone in between.

Endless Fun: Participate in our best server events, play games like Fortnite, Valorant, CoD, Roblox, Minecraft, and more, or explore our addicting bots.

Awesome Perks: Access 300+ custom emotes, cool emojis, and frequent Nitro and Robux giveaways.

Come join our chat, talk, and chill to see for yourself why our community is growing every day! Click discord.gg/activevc to join now

Today's activity
10.7k
205
59
Server overview
3.1kTotal members
6months old
13Age requirement
Only 20 humans, no more! (Voice focused, 24+, small group) Discord server profile picture
Only 20 humans, no more! (Voice focused, 24+, small group)
communitysocialchillhangoutfriendsvcvoicesmallsmall server
user profile pic
psychedelic_eye29-11-2025 09:07

hello humans. join us for actual honest conversations. we have standards. we all face our hardships of course, but we face them together. we lift each other up. we grow. and one die we'll die (okay maybe). join us on the adventure!

Description

24+ age requirement!! Voice focused! Aiming for an international community with many different countries!

We aim to have not more than 20 people in the server, keeps it tight knit and less chaotic and diluted. We're just here to connect as a small group of humans on the internet.

INACTIVE PEOPLE AND LURKERS WILL BE KICKED.

Today's activity
80
7
0
Server overview
21Total members
1years old
24Age requirement
💿 Daz ART! • MAKE FRIENDS || commissions/\ Social ✦ art Discord server profile picture
💿 Daz ART! • MAKE FRIENDS || commissions/\ Social ✦ art
artsocialcommunityfriendsactivefriendscommissionsgiveawayschilloc
Description

Haiii!! And welcome to Daz ART! (Or "That's art") meaning anything created with your hands can become art♡

This server is meant for artists and other people who are interested in art and are looking for friends that have same interests!!

This server is still quite small so it's chill but we will offer many stuff in the future. You can get special roles(kinda like achievements) while helping my community and server grow!! :D

So if you found this in your fyp or search results, THIS WAS MEANT FOR U SO CMON JOINNN ♡♡♡

Everyone is welcome :D

(No AI and follow discors tos, this server is not a dating server its meant to help you make friends, thank you.)

Today's activity
242
12
0
Server overview
559Total members
1years old
13Age requirement
Best people Discord server profile picture
Best people
socialcommunitychillgaminggameshangoutfriendsfunfriendlychatvcactiverobloxmusicminecraftmemesfortniteteenvoicechatfunnyhang outvibesmake-friendsrap13-17rainbow sixr6
user profile pic
jerkmateworldchampion21-05-2026 06:52

Join up 🙏🙏

Description

🚀 JOIN THE VIBE | 700+ DEEP 🚀
If you’re tired of dead servers, come thru to a pretty active hangout. We’re a Level 3 boosted social hub where we’re mostly just chilling, talkin in VC, and catching late-night vibes. When we aren’t just chatting, we’re running game nights for Siege, Roblox, and GTA V, and we even throw down on tournaments here and there to keep things competitive. We just hit 700 members and we’re pushing for 1000 members—no toxicity, just chill people and good energy. Stop lurking and join the rotation!

Today's activity
9.3k
149
19
Server overview
1.5kTotal members
6months old
13Age requirement
/saucee | ask2dm • egirls • dating • social • active Discord server profile picture
/saucee | ask2dm • egirls • dating • social • active
communitysocialchillroleplaygamesanimefriendsactivemoviesdatingegirlactive-voicechatedatingfreakyvc
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
48
17
0
Server overview
1.8kTotal members
1years old
18Age requirement
miao Discord server profile picture
miao
communitysocialfriendschillsmall
Description

hallo !! uhmm js another (16+) community server starting out,, come talk to us! we don't bite :3 plsplsplsplsPlease give us a chance <//3

Today's activity
847
11
0
Server overview
7Total members
11days old
16Age requirement
El Rincón Discord server profile picture
El Rincón
socialgaminggamesfriendsfunchatactiverobloxespañolespañacomunity
Description

Hola somos un servidor enfocado en el gaming pero mas centrado en Roblox y buscamos gente para jugar, divertirnos y pasarnoslo bien todos juntos.

Today's activity
208
12
13
Server overview
97Total members
1years old
14Age requirement
Impero Tassonimitiano | 0.5k Discord server profile picture
Impero Tassonimitiano | 0.5k
communitysocialchillgaminggameshangoutanimefriendsfunfriendlyartchatactivemusicrobloxvcsfwminecraftwritingmemesmoviesmangafantasyeventsgiveawaysfortnitedatingyoutubegaming-communityxboxstreamingvoice-chatplaystationcoopvideogiochiitalivememeconsole-gamingpc-gamingnintendoitalianoyoutuber-italiaserver-italianogaming-setupno-toxicsvagosfidevlogamiciziaeventibot-divertimentofan-basecommunity-unitastanze-vocalidiscord-italiagioco-onlineromagnadiscord-itachat-vocalegaming-italiadivertimento-assicuratozona-chillvideochat-testualecommunity-italianagiveaway-italiaromagnolitorneipc-master-racetwitch-italianuove-amiciziemusica-discordmultiplayerintrattenimentoincontrisassari-cityspirito-sardoromagna-mialobbygameplay-itacommunity-attivacreatori-italianirisateaggiornamenticercasi-compagninuovi-amicirelaxsassarinovitàlive-streaminggaming-italyplayer-italianicompetitivogioco-di-squadragameplaymeme-italiasardegnaanon1mitysarditassodivertimentoitaliadietro-le-quintecanali-vocali
Description

Entra nel cuore della nostra Community! 🚀

Cerchi un posto dove il divertimento è di casa? Unisciti al server Discord ufficiale creato da Anon1mity (orgoglio sardo direttamente da Sassari) e Tasso (il tocco romagnolo che non guasta mai)!

Non è il solito server statico: qui siamo una vera famiglia.

🎮 Gaming insieme: Giochiamo in live e passiamo il tempo in chat vocale.

💬 Zero barriere: Parla direttamente con noi e con centinaia di altri player.

Che aspetti? Il posto d'onore in vocale ti aspetta. Join us now!

Non regalo sogni ma solide realtà - Parola di Roberto Carlino

Today's activity
697
28
16
Server overview
539Total members
3months old
13Age requirement
FumiCity Discord server profile picture
FumiCity
gaminganimemovieschattingcollegesocialchillcommunityhangoutfriendsfunfriendlychat18+
Description

Are you lonely? Looking for some fun? Then you've come to the right place! Join this server to meet new people, chat, & play games!

Today's activity
115
12
0
Server overview
365Total members
4years old
18Age requirement
Oneirism club (Server in wip) Discord server profile picture
Oneirism club (Server in wip)
chillgaminganimefriendsfriendlyhorrorslice of lifeindie gamesvisual novelmenheradeep rock galacticlimbus companypvpe
Description

*Note: the server is currently wip. feel free to leave out any suggestions, ideas, or feedback to improve the server

Oneirism club is a friendly and casual/chill community server inspired by Mushishi. The server is mainly for those who enjoy Limbus company (or any of Pjmoon works), charon games, pvpe games like deep rock galactic, frostpunk and more.

We also welcome discussion on anything in general from books, anime, movie, and other topics^^

our aim is to make sure that you have the best experience and that it's confort haven for everyone. We are all about companionship and mutual respect. fan or newcomers alike, everyone is welcome.

Join and be part of our club.

Today's activity
379
4
0
Server overview
311Total members
6years old
16Age requirement
🧃PICNIC PARTY🧺 Discord server profile picture
🧃PICNIC PARTY🧺
friendshobbiesnon-toxic14+bugs
Description

It's a Picnic Party!!! What we have: Hobby-centered channels | Non-toxic welcoming community | Small but active server | Focus on fun & making friends | Active voice chat!!! | Cute emojis | Picnic Party is a small community of people interested in making friends and having a good time. Some of us like bugs, reading, music, & art, but any niche interest you have is welcome! We are completely open to suggestions and would love to get to know you. See you at the party! 🐜

Today's activity
76
6
0
Server overview
41Total members
2years old
14Age requirement
PEPTIDES TECH Discord server profile picture
PEPTIDES TECH
healthweightlosspharmacyfitnessbodybuildingweightgainsteroidspeptidesactivecommunitysocialfriendschillfun
user profile pic
fabricaroger7422-11-2025 04:25

best weightloss server

Description

Get prescription weight loss treatments Mounjaro, Wegovy, Orlistat ,Xenical ,Steroids and more

Today's activity
72
29
0
Server overview
282Total members
7months old
18Age requirement
The Eternal Flame Discord server profile picture
The Eternal Flame
internationalchillfriendslgbtfemale
Description

Eternal Flame - the International Community with regular events including holiday parties, eurovision and sport watch parties, movie nights. An inclusive and mature group that fosters a wholesome and chill culture.

Today's activity
58
5
5
Server overview
110Total members
6years old
20Age requirement
Fluid Client Discord server profile picture
Fluid Client
communitysocialactivechillroleplaygaminghangoutgamescreativefriendsfunfriendlyartchatmusicvcsfwrobloxminecraft
Description

Ready to take your Minecraft adventures to the next level? Fluid Client, the unrivaled Minecraft client for 1.8.9, is your ticket to endless possibilities! 🌍 Unleash your imagination, conquer challenges, and build your way to victory! Download now at https://fluidclient.ovh/download.

Today's activity
53
23
1
Server overview
9.6kTotal members
3years old
13Age requirement
Cherry Blossom BL Energy Discord server profile picture
Cherry Blossom BL Energy
communityanimesfwmangagaylgbtqblotakuyaoimlmmanhwamanhuafudanshiboys love13-17socialhangoutfriendsfunfriendlychatlgbtq+
Description

🌸 Cherry Blossom BL Energy — A cozy Boys’ Love chat community for fans, recommendations, discussions & safe vibes. 🌸 Cherry Blossom BL Energy Welcome to our peaceful garden beneath the cherry blossoms — a cozy 16+ Boys’ Love community made for connection, comfort, and shared love for BL. The blossom garden is our main hangout space where you can: 💮 Chat freely about your favorite BL anime, manga, manhwa & novels 💮 Make new friends who share your interests 💮 Share edits, recommendations, thoughts & headcanons 💮 Relax in a calm, drama-free environment 💮 Just exist and vibe together Whether you're here for soft romance, emotional stories, chaotic ships, or wholesome comfort — you belong here. 🌷 Our Atmosphere We focus on: ✨ Cozy energy ✨ Respectful conversations ✨ LGBTQ+ positivity ✨ Safe interactions ✨ Community over chaos This is not an explicit server. We prioritize comfort and safety while still allowing open BL discussions in an appropriate way. 🌿 Community Rules Overview 💮 16+ Only – No one under 16 allowed. 💮 Respect Always – No harassment, hate, or discrimination. 💮 Safe LGBTQ+ Space – Everyone deserves to feel welcome. 💮 No Graphic NSFW – Keep content appropriate. 💮 Zero Tolerance for Minors in NSFW Contexts – Instant ban. 💮 No Creepy Behavior – No pressure DMs or unwanted flirting. 💮 Respect Privacy – No sharing DMs or personal info. 💮 No Drama or Spam – Keep the garden peaceful. If you're looking for a calm BL space that feels like late-night chats under falling petals instead of chaotic noise — Cherry Blossom BL Energy is waiting for you 🌸💕

Today's activity
298
11
0
Server overview
237Total members
4months old
16Age requirement
StarCity・Social・VC・Sing・Hangout・Art・Memes・Gaming・EGirl・Active・Chat・Friends - E for Everyone! Discord server profile picture
StarCity・Social・VC・Sing・Hangout・Art・Memes・Gaming・EGirl・Active・Chat・Friends - E for Everyone!
socialchillgameshangoutactivefriendsgamingfunfriendlyartchatvcrobloxminecraftamonusrepomemesfortnitevalorantnitrogiveaways
Description

**💎 Color Roles 👑 Create Custom VCs 💬 Active 🦑 VC Game Nights 🤝 Friends 🎉 Fun 🏓 Chats 🍃 420 🎁 Nitro Giveaway Challenges 🎮 ⭐️ Instant Pic / Color Perms ⭐️ + partnerships Join! <3 👉 Join the Fun!**

Today's activity
28
11
0
Server overview
10.7kTotal members
6years old
13Age requirement
Jax's Haven Discord server profile picture
Jax's Haven
communitygaminghangoutfriendschattingnontoxicmoviesocialchillfriendlyartminecraftmoviessfwenglishnon-toxicmake friendsgames
Description

。゚•┈୨♡୧┈• 。゚
Jax's Haven is a discord server dedicated to making friends and hanging out! We love movies, having at least weekly movie nights. We also have plenty of gaming roles, and we're willing to add more so you can ping to find people to game with!

We are not 18+ exclusive but prefer if you are. We try to keep it a little more lax, but are stricter with toxicity.

We have:
╰┈➤ Movie Nights (At least Weekly!)
╰┈➤ Occasional Giveaways
╰┈➤ Frequent Game Nights
╰┈➤ Chill Environment
╰┈➤ Great Mod Support
╰┈➤ LGBT+ Friendly Folks
╰┈➤ Semi-Active VCs, mostly CST times
╰┈➤ VC Music Bot

While we do allow occasional NSFW jokes, it's a primarily SFW server.

Today's activity
15
3
0
Server overview
84Total members
1years old
15Age requirement
Monarch's Domain Discord server profile picture
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
787
30
11
Server overview
1.1kTotal members
3years old
13Age requirement
Якудза Discord server profile picture
Якудза
socialchillgaminggamesworld of warcraftjapancommunityroleplayanimefriendsfunfriendlyartchatactivemusicmemesmoviesrpmangaeventsprogrammingcreativenon-toxicvoicechattingreading
Description

Невыносимые ограничения, дотошные лицемерные правила... Устали от всего этого? Ищете взаимопонимания? В нашем самом вольном объединении рады всем, кто на стороне Справедливости.
Вступайте в семью!

Мы - атмосферное сообщество, объединяющее людей разных фриланс-профессий, талантов и интересов. Наш оригинальный подход направлен на поддержание духа свободы и взаимопомощи.

На нашем уютном сервере вы найдёте:
✓ Приветливое сообщество фрилансеров с анкетами для работы
✓ Дизайнерскую стилизацию под японскую тематику с аутентичными картинками и философскими фразами с глубоким смыслом
✓ Уникальную демократическую систему политической жизни сервера с выбором клана
✓ Разнообразные чаты для вольного общения, игр и интересов
✓ Своя вольная гильдия без требований в World of Warcraft
✓ Полную свободу выбора и действий

В нашем самом свободном сообществе каждый найдёт для себя своё место!

Помните главное:
Вместе мы подобны течению десяти тысяч рек, впадающих в океан. Объединение - вот ключ к успеху.

Today's activity
17
6
0
Server overview
122Total members
4months old
16Age requirement
Kvirdom Discord server profile picture
Kvirdom
socialchillgameslgbtlgbtqlgbtq+gaytransbiserbiaserbiancroatiacroatianbosniabosnianbalkansbalkanslaviceuropeeuropeancommunityfungamingidentityfriendsfriendly
Description

This is a safe online space for any and all queer people in the Balkans (specifically we have channels for South Slavic languages and for English). Join to meet cool people and have fun!

Today's activity
3.3k
49
0
Server overview
508Total members
1years old
13Age requirement
Description

✉️ SEND OR RECEIVE DM REQUESTS! ✉️ Step into a welcoming community where every member can shape their own identity. 🎭 With 150+ self-assignable roles, you can showcase your hobbies, interests, personality, and more.

Discord Dating Server, Dating Discord Server, 18+ Discord Server, Discord Dating Community, Online Dating Discord, Discord Love Server, Discord Singles Server, Dating Server Discord, Discord Chat Dating, Discord Relationship Server, join dating discord server, best discord dating servers, active dating discord server 18+, safe dating discord community, meet singles on discord, discord server for dating and relationships, discord matchmaking server, discord flirt server 18+, find partners discord server, real-time chat dating discord, best 18+ dating discord servers to join, active discord dating servers for adults, how to find dating servers on discord, discord servers for singles and relationships, safe discord dating communities 18 and up, discord server to meet new people romantically, discord dating chat rooms 18+ active users, join discord server to meet singles online, best places to meet people on discord for dating, dating and friendship discord server 18 plus, discord social server, discord friendship and dating, online community for singles, meet people online discord, casual dating discord server, serious dating discord community, voice chat dating discord, text chat dating server, gaming and dating discord server, international dating discord server, adult discord dating chat, discord meetup server, social discord for adults, flirt and chat discord server, relationship building discord server, singles chat 18+ discord, make friends and date discord server

Today's activity
24.0k
1.2k
89
Server overview
7.7kTotal members
4years old
18Age requirement
Friend Hunters 3000 ULITIMATE Discord server profile picture
Friend Hunters 3000 ULITIMATE
socialfriendscommunityfriendlyhangout
user profile pic
psychedelic_eye11-07-2023 13:55

Hey potential discord server searcher! You should checkout this server because uhhh we be cool and have cookies.

Description

Just a discord server for making friends. People from all around the world, with all sorts of interests. We also have a friendship match making project. And tons of cat emojies! Why not pop by and tell us how your day went? What your plans are for the week if anything? What are you looking forward to? Or just share some sad stuff, anything goes. We're all humans. :) Hope to see you there! :D

Today's activity
6
3
0
Server overview
300Total members
5years old
13Age requirement
Clube dos programadores Discord server profile picture
Clube dos programadores
programaçãogamingchatfriendsmemesprogrammingtecnologiatechnology
Description

🚀 Clube dos Programadores

Uma comunidade para desenvolvedores, estudantes e entusiastas da tecnologia.

Aqui você pode compartilhar projetos, aprender novas linguagens, tirar dúvidas, encontrar recursos úteis e conversar com outros programadores.

Seja você iniciante ou experiente, há espaço para evoluir, colaborar e criar coisas incríveis.

💻 Programação
🤖 Inteligência Artificial
🌐 Desenvolvimento Web
📱 Aplicativos
🎮 Desenvolvimento de Jogos

Junte-se à comunidade e faça parte dessa jornada!

Today's activity
24
4
0
Server overview
27Total members
1months old
13Age requirement
⟡ : ➜ ⊂ Mon Chérie ⊃ ♡ Discord server profile picture
⟡ : ➜ ⊂ Mon Chérie ⊃ ♡
semi-toxiccommunitysilly fun serverfriendly communityfriendly stafffriends
Joininactive
Description

(\ (\
(„• ֊ •„)
━O━O━━━━━━━━━
・:。𝐢𝐧𝐯𝐢𝐭𝐚𝐭𝐢𝐨𝐧「 ✉️ 」・:三
━━━━━━━━━━━━━

∧_∧

  (。・ω・。)つ━☆・*。
⊂/  /  ・゜
しーJ    °。+*°。
.・゜

゜。゚゚・。・゚゚




Interested in joining the server? Well I’ll tell YOU what WE offer!

✦﹒🍒﹒A safe community. People in the server are really nice! Yeah we are mean here and there, but it’s mainly as a joke! If you don’t like what someone said to you or your friend in the server, don’t be afraid to tell us, we’ll gladly deal with the problem!﹒

︶︶﹒Nice staff members. The members in the staff are an interesting bunch, but I promise that we all are very nice!﹒🌸

﹒🎀﹒✿﹒Lots of channels and bots.

﹒౨ৎ﹒➲﹒A decently messy server layout

lıl﹒Cute/fun emojis﹒ᯓ★﹒

﹒☁︎﹒Server Age Requirement: 13-18﹒❀

♡﹒Server is SFW or BSFW﹒﹒⊼

︶︶﹒🍓﹒Suggest channel for bots and/or channels. There’s room for improvement in this server!

Today's activity
81
2
0
Server overview
46Total members
2years old
13Age requirement
Dughmosh Community Discord server profile picture
Dughmosh Community
chillgamingfriendscommunity
Joininactive
Description

Welcome to our Discord server! 👋✨ We are an active and friendly community 🤍 focused on chatting 💬, making new friends 🤝, and having a great time together 🎉. Our server offers a welcoming atmosphere 🌟, respectful members ✅, and a helpful staff team 🛡️ to ensure everyone feels comfortable. Whether you want to talk 🗨️, hang out 👥, or just relax ☕, this is the perfect place for you. Join us and be part of our growing community 🚀💙

Today's activity
37
2
1
Server overview
363Total members
9months old
13Age requirement
Swagalicious center Discord server profile picture
Swagalicious center
communitysocialartchillfriends
Joininactive
Description

Welcome to swaglicious center!!
ヽ(≧∀≦)ノ
If you like ranting about your interests and ocs and sharing your art then you should consider joining our server!! We are very accepting of anything that people consider “cringe” or weird!!
(★ᴗ★)

Today's activity
8
1
0
Server overview
19Total members
2years old
13Age requirement
Nexus Community Discord server profile picture
Nexus Community
communitydevelopersdesignersself-promocollaborationprojectsfriendswelcomingactive
Joininactive
Description

Hey, YOU! 🫵 While working on a big project, working alone is not the best option. Having more hands 🖐️ on it is. At Nexus we provide the mediums and resources for that. With an engaging community, and developers + designers at your fingertips, there's nothing you can't accomplish together. While the server may be small, Nexus is deemed to become one of the biggest platforms and servers for projects and engagement! Nexus, where developers and designers unite. 🤝 Join now!

Today's activity
8
1
0
Server overview
46Total members
2years old
13Age requirement

105 servers found