Focused Discord servers

🔎 Search
🏷️ Tags
🔞 Age Requirement
📊 Sorting
👥 Server Size
📅 Server Age
🌍 Language
🎭 Vibes

311 servers found

Blox Fruits Trading Server | Trading Discord server profile picture
Blox Fruits Trading Server | Trading
bloxfruitsbloxfruitblox-fruitsblox-fruitblox fruitsblox fruitblox fruit trading serverbloxsfruitsbloxs fruitsbloxsfruits
Description

Welcome to Blox Fruits Trading Server – the ultimate Blox Fruits Discord server! We’re the go-to place for safe and verified trades, real-time Blox Fruits stock prices, middleman services, and expert help for players of all levels. 💼 TRADE SMART: ✅ 24/7 Active Trading Community ✅ Fruit-for-Fruit, Gamepass & Limited Trading ✅ Trusted Middlemen to keep your deals safe 📈 INVEST WISELY: ✅ Live Fruit Market & Stock Charts ✅ Daily Value Updates for All Fruits ✅ Smart Trading Advice 🆘 GET HELP & LEVEL UP: ✅ Boss Guides, Crew Invites, and Leveling Support ✅ Friendly Community to Help All Seas & Levels ✅ Support Channels + Trading Guides 🎁 BONUSES: 🎉 Regular Fruit Drops & Gamepass Giveaways 🎖️ Reputation System for Verified Traders 🌍 Global Community – All Time Zones Supported Join the best Blox Fruits Discord today and take your trading and gameplay to the next level! [ 🔗 https://discord.com/invite/blox-fruit]

Today's activity
18.8k
1.1k
10
Server overview
13.0kTotal members
6months old
13Age requirement
RS MEDIA Discord server profile picture
RS MEDIA
iptvplexembylive tvpremium iptvtrials availablesportsvodentertainment
Description

Your one stop shop for premium entertainment. We currently have 4 of the best private IPTV service to choose from. We also offer a wide selection of vod only services stremio and large plex, emby servers in 4k remux. Trials are available.

Today's activity
36
9
0
Server overview
214Total members
3months old
15Age requirement
Rus' | Into The Frost Discord server profile picture
Rus' | Into The Frost
adventurefantasymedievalroleplay
Description

With a long winter preparing to encapsulate the Tsardom of Rus' and all living things within the Russkaya Zemlya, we invite you to join us in the new and improved Rus' Universe. Dobro pozhalovat' v Rus! Welcome to the Rus', my friend. The "Rus' | Into The Frost" is a server based on 15th-Century Medieval Russia with a fantasy twist. Imagine a world where legendary creatures found in traditional folklore coexisted alongside ManKind. It is in our universe that adventurers from all corners of the globe travel to the Land of the Rus' to test their mettle against the ferocious beasts that dominate the cold lands. Limited by only your own brilliant creativity, you are allowed to start off as a majestic and nimble Kitsune from the Far East—using magic to turn your foes to dust. You can even try to slay beasts as an Elven Archer from the Germanic Region who can strike down their prey from miles away, a werewolf, vampire, orc, and so much more. Don't be afraid to strive for whatever your artistic mind desires. This is a community that accepts all passionate to write, role-play, and help build an immersive universe influenced by its members and everything we do as a community. Upon joining, we ask that you take the time to read the instructions provided in our welcome channel. We are a very well-written and fleshed-out server. We hope that you'll be joining us very soon on our courageous adventures, friend.

Today's activity
28
8
0
Server overview
42Total members
3years old
18Age requirement
StudyBuddy Discord server profile picture
StudyBuddy
socialcommunitychillstudyeducationresourceenglishmathematicsphysicslanguageieltssattoeflphysicshistorystudyingstudy with meschoolcollegeworkhomeworkproductivitystudy togetherhangoutlearningfriendlyinternational
Description

📚 Join StudyBuddy – Your Ultimate Study Partner Hub! 🎯 Looking for a study buddy to keep you motivated and accountable? Want a friendly space to focus, share resources, and stay productive? Then StudyBuddy is the perfect place for you!

Today's activity
11
7
2
Server overview
842Total members
1years old
13Age requirement
Girls Frontline: Mercenaries Discord server profile picture
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
211
13
0
Server overview
200Total members
3years old
13Age requirement
LEARN DROPSHIPPING Discord server profile picture
LEARN DROPSHIPPING
ecommercedropshippingshopifyresellprint on demand
Description

Learn Dropshipping is a free Discord community for beginners who want to start a Shopify dropshipping business from scratch.
💡 Inside you'll get: • Free step-by-step dropshipping guides
• Shopify store setup support
• Product research and winning product ideas
• Store reviews and feedback
• Facebook Ads & TikTok Ads discussions
• Supplier sourcing tips
• Beginner-friendly Q&A channels
• Networking with e-commerce entrepreneurs
✅ Free community with no paid courses required. Learn from other entrepreneurs, ask questions, get feedback, and grow your skills without expensive mentorship programs or guru courses.
Whether you're building your first store or looking to improve your results, our community helps you avoid costly mistakes and learn from real sellers.
🔥 Join hundreds of entrepreneurs and start your dropshipping journey today

Today's activity
453
129
1
Server overview
1.4kTotal members
7months old
13Age requirement
Purple Pill Pretties Discord server profile picture
Purple Pill Pretties
astrologyincelneetblackpillfemcelchudugly
Description

A lightly-modded debate hub built for sharp minds and unfiltered discussion.

Today's activity
18.1k
123
3
Server overview
509Total members
9months old
18Age requirement
kaninchenhausinosu Discord server profile picture
kaninchenhausinosu
one pieceanimedebatepowerscalingmudaekarutamangacommunitysocialchilldiscussiononepiece
Description

Welcome to Hachinosu! As the official server of r/OnePiecePowerScaling, all One Piece powerscaling is welcome.

Today's activity
8.7k
91
0
Server overview
3.0kTotal members
3years old
13Age requirement
ZynxReps Discord server profile picture
ZynxReps
repskakobuyreplicasspreadsheetcnfans
Description

╭°•.○.•°💚Zynx Reps🍀°•.○.•°╮ ✨ Ultimate Spreadsheet - Our exclusive spreadsheet features over 13,000+ hand-picked items in Best Batch quality (1:1) from top sellers. 💫 📸 QC Converter - Drop a photo/link and our system will find a cheaper alternative of the same quality with real QC photos. 🛟 1:1 Support - We assist you at every stage - from your first order to advanced tips. 🍬 Giveaways & Coupons - Regular giveaways and limited-time coupons. 👥 Community - A place where everyone shares knowledge and helps each other. 🧩 Join our elite community of rep lovers and stop overpaying for the same quality! ╰°•.○.•°💚Zynx Reps🍀°•.○.•°╯

Today's activity
2.6k
8
0
Server overview
2.3kTotal members
7months old
13Age requirement
Real Time News Discord server profile picture
Real Time News
politicsnewsgeopoliticsconflictsweather
user profile pic
tectonic345225-06-2025 15:40

hello

Description

# 📰 __Real Time News __📰
## The best discord server for live breaking news



Live Breaking News is a spot for coverage and discussion on live news and events all across the world. **From politics, geopolitics, conflicts, weather, sports, or anything else you're interested in.** We have a spot for it all.

We aim to create a place **free from toxicity** while also allowing those of all view points to come and discuss and allow different sources of news. We also have an **unbiased administration** aimed to allow for free sharing of news in the server.

### **To summarize + other additions to the server:**
- Channels for different regions, topics, and conflicts
- Non toxic environment + a place for all view points
- Unbiased administration team
- Daily news recaps
- Breaking news pings
- Bots to use for fun
- **Looking for partnerships with other servers**

## **Join Real Time News today!**

Today's activity
7.9k
63
0
Server overview
1.4kTotal members
1years old
13Age requirement
Better C++ Discord server profile picture
Better C++
programmingcppc++pythonstudyingcoding
user profile pic
fatlenny10-02-2025 15:49

What is a shoutout

Description

Better C++ is a programming community with primary focus on C++. Discussion and help requests for other languages such as C, Rust or Python are also welcome. If you are a developer or aspire to be one, this community is perfect for you.

Today's activity
2.5k
60
1
Server overview
16.1kTotal members
7years old
14Age requirement
Chris Tech Tips Discord server profile picture
Chris Tech Tips
technologyacceptingprogramminglinuxwindows
Description

A non-toxic, all-inclusive space to talk about technology. Newcomers are always welcome!

Today's activity
212
9
0
Server overview
147Total members
2years old
16Age requirement
Temu L4L! Discord server profile picture
Temu L4L!
temul4ltemu-l4lreferal
Description

Do you want to get people to click your temu link? No worries! Join the server and get people to use your referral link! This server currently has 2.5k+ members and has a concurrent amount of users doing L4L ! There's a general chat with level roles and a role that'll show that you more trustable than others if you want aswell!

Today's activity
47
12
0
Server overview
5.1kTotal members
3years old
13Age requirement
Grow A Garden 2 | Stock Notifier & Predictor 24/7 Discord server profile picture
Grow A Garden 2 | Stock Notifier & Predictor 24/7
robloxstock predictorstock notiifergarden horizonsgardenhrzn
Description

discord.gg/gardenhrzn - Garden Horizons Stock Notifier & Predictor Discord Server | Join for Giveaways, Leaks, Codes, Updates, Guides, Events, 24/7 Friend Boost and more!

Today's activity
239
15
0
Server overview
29.6kTotal members
1years old
13Age requirement
OMICRON Discord server profile picture
OMICRON
hackshackhackingkalidarknetdark-webcyberhackerdarkwebdark-netlinuxdeepnetdeep-netnmapdeep-webdeepwebsecurityprogramming
Description

TL;DR: A hacking-themed knowledge-sharing community & marketplace.

On our server, we facilitate the sale of various products while also aiming to build a community. Our goal is to bring people together to engage in discussions about relevant products, fostering growth within our community.

We encourage sharing experiences and recommendations about the products within our community. Our moderators are active to provide a supportive environment on our server for helping each other and exchanging information. They are ready to assist you with any questions or suggestions you may have.

We look forward to your participation and engagement in our community. Feel free to reach out to our moderators with any questions or suggestions you may have.

We also have a great bot that let's you do lots of cool stuff. One of its features is it lets you download any book if you know the name.

Today's activity
345
7
0
Server overview
330Total members
3years old
13Age requirement
Cano Scrims Discord server profile picture
Cano Scrims
fortniteocescrimslflfglfdoceania
Description

Main Oceanic (OCE) Fortnite Scrim Discord | Open to everyone!

Today's activity
8.5k
936
28
Server overview
72.3kTotal members
7years old
13Age requirement
Chat Makes Pokemon Game Cord Discord server profile picture
Chat Makes Pokemon Game Cord
pokemonfakemoncommunitygamingchillfunwritingmusicspritingartfangamesocialpoketwo
Description

Welcome to Chat Makes Game, where YOU can help make a Pokemon fangame! Join with 700+ members in cocreating a Pokemon fangame! Have a chance of having YOUR characters and fakemon in the game! Join livestreams with other people where we take YOUR suggestions and add them to the game!

Today's activity
264
49
0
Server overview
3.2kTotal members
2years old
13Age requirement
Studienkolleg Discord server profile picture
Studienkolleg
studienkollegstkstudiumgermanyaufnahmeprufungaufnahmeprüfungaufnahmepruefung
Description

This server aims to help people on their journey through Studienkolleg, be it from just starting to learn German, to the Festellungsprüfung. This server is associated with the r/studienkolleg subreddit.

Today's activity
588
49
0
Server overview
4.4kTotal members
3years old
13Age requirement
Aria Drama & Voice Discord server profile picture
Aria Drama & Voice
voice actingscreenplay
Description

Welcome to VTC: Your Home for Creativity and Connection VTC is more than just a meeting place; it's a vibrant community where voice talents, actors, singers, directors, mixers, and a spectrum of creative minds converge. Elevate your craft with our exclusive acting lessons, designed to bring out the best in you. But VTC is more than a learning hub; it's a dynamic social network where connections flourish. Strengthen bonds with peers who share your passion, whether you're a seasoned actor or a budding director. Our doors are wide open, inviting you to a space where creativity thrives, and friendships blossom. Join VTC, where every voice finds its stage, and every talent finds its tribe. 🎭✨

Today's activity
1.9k
47
8
Server overview
1.4kTotal members
5years old
16Age requirement
The Gemini Game Discord server profile picture
The Gemini Game
anime rpanime roleplayvideo game rpmfrpmultifandom rpmultifandom roleplayrp serverroleplay serverrp grouprpganime rpggroup roleplaygroup rp
Description

╘══ ✧【 A game played across the stars and across time, the Gemini Game is a once in a lifetime opportunity for those who have found their lives cut short: a chance to live again upon winning the game. All one needed to do was sign the contract offered by the Game Masters, Almir and Ivill, and complete the tasks set before them. Both seemed strange, cold even, yet they offer up contracts to all who were about to perish with a soft smile. It's hard to tell what their end goal is and if the people are saved as a kind gesture or simply because the two needed something to play with. Yet one thing is very clear: both wish to win their side of the game and none will live again without the blessing from one of the twins. It was a simple task to be victorious over another team, and yet it seemed as if this game wasn't all that it appeared to be. Each day the Nest, the large spaceship that one awakes on, sails through the galaxy, and each day it seemed as if rebirth was drifting away with each world passed. Small game after game is played, each winning a Crown and a small reward, and yet no game seems to be the final one. So welcome aboard, and enjoy playing the Game that will determine life and death. 】✧ ══╗ ✪ An ongoing, overarching plot as well as quarterly AU settings that tie in ✪ ━━━━━━ ✪ Short-action and para style roleplay channels ✪ ━━━━━━ ✪ NSFW content is permitted but contained to its own area ━━━━━━ ✪ Open to characters from all fictional source material, as well as OCs ✪ ━━━━━━ ✪ Regular events and games to participate in ✪ ━━━━━━ ✪ LGBTQIA+ friendly! No bullying or discrimination tolerated ✪ ━━━━━━

Today's activity
848
42
0
Server overview
136Total members
3years old
18Age requirement
VintHelper | Vinted Free Bot Extension Discord server profile picture
VintHelper | Vinted Free Bot Extension
vintedvinted-botvinted-helpresellreselling
Description

This is the official Discord server for VintHelper, the all-in-one browser extension designed to automate and scale your Vinted wardrobe. Whether you are a casual seller clearing out your closet or a power reseller moving serious volume across Europe, you’ve found your home.

Today's activity
104
34
0
Server overview
164Total members
2months old
13Age requirement
StarWars: RP Discord server profile picture
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
621
34
0
Server overview
286Total members
4years old
16Age requirement
Clippers HQ Discord server profile picture
Clippers HQ
clipsclipclipperclipperscreative
user profile pic
andrewthegoat_107-08-2025 17:45

Join up

Description

✂️ Join Our Private Clipping Network We connect skilled editors with influencers who need viral short-form content. You focus on editing we handle the rest.

Today's activity
223
31
0
Server overview
6.8kTotal members
1years old
13Age requirement
Zombie Gaming Discord server profile picture
Zombie Gaming
gaming communitygaming-communitygamingzombiezombie gamingzombie-gamingzombieshorrorcommunity7daystodiel4d2zpsleft4deadzombie panicnmrihno more room in hellpc gamingconsole gaminggamerssteam
Description

The Zombie Gaming [ZG] Community was founded in November 2008 dedicated to the mission of providing the finest community gaming experience for those who love the Zombie / Horror genre. Our membership extends all around the world with many who actively contribute in building a premier gaming community environment. Our focus is on all past and present popular Zombie Games, Television and Movies. This community is open to all and we welcome you to join us today.

Today's activity
9
4
2
Server overview
1.1kTotal members
9years old
14Age requirement
Coze & Prose (25+) 📝 🌈 Discord server profile picture
Coze & Prose (25+) 📝 🌈
writingwriting communitywriters25+nanowrimo
Description

📚 25+ Writing Community 📚

💜 Friendly, wholesome community for writers 25 and older
🌈 LGBTQIA+ friendly and safe space
🏃 Writing sprints, writing challenges, and group writing sessions
📣 Promo space for writers to post blogs and social media
🎨 Channels for every stage of the writing process
✨ Custom emojis

Today's activity
170
27
0
Server overview
1.4kTotal members
2years old
25Age requirement
The Storytellers Guild Discord server profile picture
The Storytellers Guild
artmusicanimationwritingactinggaming
Description

The Storytellers Guild, a Discord server for artists, writers, musicians, animators, actors, and all kinds of creators. It’s themed like a fantasy adventurers guild with RPG elements: you pick a class (Warrior, Rogue, Mage, etc.), earn XP, do quests, join events, and level up while creating and collaborating with other people. It’s been pretty fun so far — we’ve got weekly game nights, movie nights, art challenges, a quest board, and a solid group of people sharing work and giving feedback.

Today's activity
225
26
22
Server overview
139Total members
1months old
18Age requirement
Precision Peptides Discord server profile picture
Precision Peptides
fitnessgympeptidepeptidesweight loss
Description

Precision Peptide is a trusted source for premium-quality research peptides, dedicated to supporting scientific innovation through exceptional product quality and reliable service. We provide carefully sourced peptides that undergo rigorous quality control to ensure purity, consistency, and accuracy for laboratory and research applications. Our commitment to transparency, fast order processing, and secure packaging allows researchers to focus on their work with confidence. Whether you're conducting academic studies, biotechnology research, or pharmaceutical development, Precision Peptide aims to be a dependable partner by delivering products that meet high industry standards. We continuously strive to improve our catalog and customer experience while maintaining professionalism and integrity in everything we do. At Precision Peptide, precision isn't just our name—it's the foundation of our commitment to advancing scientific research with dependable products and outstanding support.

Today's activity
26
9
0
Server overview
47Total members
12days old
13Age requirement
It's Your Power! Discord server profile picture
It's Your Power!
roleplayrpmhamy hero academiamha-rproleplayingmy hero academia-roleplay)my hero academia-rppartnership
Description

🌟 IT’S YOUR POWER! — MY HERO ACADEMIA RP 🌟

🦸‍♂️ Do you have a hero OC?
🦹 A villain with a cause?
👤 Or a civilian just trying to survive in a superpowered world?

It’s Your Power! is a My Hero Academia–based roleplay server set in a post-war, hybrid timeline, where hero society is rebuilding—and redefining itself.

In this world, most humans possess Quirks, superhuman abilities that shape daily life, careers, and conflict. Hero schools still stand, villains still lurk, and the line between right and wrong has never been thinner.

What sets us apart?

✨ Play who you want.
You’re not limited to hero students. Play:
Hero students, Pro Heroes, Villains, Vigilantes, Civilians, Support and business roles
…and more.

🏫 Multiple Hero Schools

U.A. High School

Shiketsu High School

Deika City University (DCU) — a bold, experience-first hero institution

📖 Story-Driven World
The world reflects the consequences of canon events, while leaving room for player-driven stories, growth, and server-wide arcs.

🌈 Inclusive & Community-Focused
Whether you’re here for intense plots, character development, or casual RP, there’s a place for you.

🔹 What We Offer:

• Friendly and welcoming community
• Clear rules and active staff
• Self-assignable roles
• Open RP channels (no forum locking)
• RP events and story arcs
• LGBTQ+ friendly environment
• Unlimited original characters
• Canon characters available to claim
• Partnerships welcome

Step into a world where power doesn’t define destiny.

It’s not about the Quirk you’re born with.
It’s about what you choose to do with it.

💥 It’s Your Power! 💥

Today's activity
360
24
0
Server overview
224Total members
7months old
15Age requirement
PA TRADING | Crypto - Forex - Stocks | Discord server profile picture
PA TRADING | Crypto - Forex - Stocks |
cryptoforextradingeducationfinance
Description

Learn how to trade - not just follow signals. PA Trading is a community focused on trading, following price action (PA) principles. Whether you’re trading crypto, forex, or stocks, you’ll find lessons, breakdowns, and real discussions with traders who want to improve. No hype. No get-rich-quick. Just real education and progress.

Today's activity
80
10
1
Server overview
599Total members
1years old
13Age requirement
Fusion Shop Discord server profile picture
Fusion Shop
shopmarketvalorantfortnitevbucksrobloxrobuxcheapnitroboostdiscordservercommunitygamingfollowersaccountfortnite accountvalorant accountcomptescomptes valorantshop valorantshop fortniteshop gamingmarket gamingfortnite shopvalorant shoproblox shopvbucks cheaprobux cheapvp cheapnitro cheapnitro fastboostingboosting valorantboosting fortnitefortnite skinsvalorant skinsrare skinsstacked accountssmurfsmurf valorantaccounts cheapcomptes pas cherboutiqueboutique gamingboutique fortniteboutique valorantstoredigital storetrustedlegitverifiedvouchesfast deliveryinstant deliverycheap shopbest priceslow pricepromodealsgaming communitygaming serversellventeeconomymarketplacegaming marketplaceaccount shopskin shopitems shopservicesupportfrfranceenglishen
user profile pic
pwbn24-11-2025 18:09

Join us !

user profile pic
pwbn24-11-2025 18:09

💎 Join us now! 💎 🎁 Our Offers 🎁 🔥 Fortnite & Valorant Accounts 🎯 V-BUCKS 🎮 VALORANT POINTS (VP) 💠 ROBUX 🛒 Nitro Boost • Accounts • And much more... 💬 Fast Support | ⭐ +250 vouches 🛒 Join us now!

Description

💎 Join us now! 💎 🎁 Our Offers 🎁 🔥 Fortnite & Valorant Accounts 🎯 V-BUCKS 🎮 VALORANT POINTS (VP) 💠 ROBUX 🛒 Nitro Boost • Accounts • And much more... 💬 Fast Support | ⭐ +250 vouches 🛒 Join us now!

Today's activity
25
24
0
Server overview
2.7kTotal members
1years old
13Age requirement
Cloud Tinkerers Discord server profile picture
Cloud Tinkerers
techcommunitydevopsprogrammingcloudkubernetes
Description

A community of tech professionals and enthusiasts. If you have an interest in cloud technologies, engineering, DevOps, SRE, system administration etc. and want to discuss and grow alongside other professionals, check us out!

Today's activity
785
22
0
Server overview
984Total members
4years old
13Age requirement
Moémon Official Discord server profile picture
Moémon Official
moemonpokemongbaromhackgamingcutepixelartanimeartfanartnds
Description

We are a dedicated community that makes cute Moémon sprites and mods for GBA games.

Today's activity
111
111
0
Server overview
37.9kTotal members
5years old
13Age requirement
PEPTIDES TECH Discord server profile picture
PEPTIDES TECH
healthweightlosspharmacyfitnessbodybuildingweightgainsteroidspeptidesactivecommunitysocialfriendschillfun
user profile pic
fabricaroger7422-11-2025 04:25

best weightloss server

Description

Get prescription weight loss treatments Mounjaro, Wegovy, Orlistat ,Xenical ,Steroids and more

Today's activity
40
21
0
Server overview
310Total members
8months old
18Age requirement
Ulus TV Discord server profile picture
Ulus TV
newshaberturkcetürkiyebelgeseltürkçeturkish
Description

Ulus TV, Discord'un en büyük haber sunucusu! Binlerce sunucu tarafından takip edilen Ulus TV haber kanalı, ülkemiz ve dünyadaki son gelişmeleri anında sunucunuza ulaştırıyor. 06.02.2023'ten bu yana; kendimiz için değil, bağlı bulunduğumuz ulus için el birliğe ile çalışıyoruz. Ulus Spor kanalımız 700'den fazla sunucunun takibiyle Discord platformunun en büyük spor haberleri kanalı! Başta futbol olmak üzere diğer önde gelen spor dallarındaki gelişmeleri Ulus Spor ile takip edebilirsiniz. 3. kanalımız olan Ulus Oyun ise en yeni kanalımız. Oyun dünyasındaki gelişmeleri, indirimleri ve iddiaları da Ulus Oyun ile sunucunuzda görebilirsiniz. Ulus TV sunucusunda diğer Ulus takipçileriyle iletişim kurabilir, şikayet ve taleplerinizi doğrudan ekibimize iletebilir ve Ulus kalitesini kendi sunucuna getirebilirsiniz! Bu Ulus, senin ulusun.

Today's activity
264
19
4
Server overview
1.7kTotal members
3years old
13Age requirement
PEDS  TALK Discord server profile picture
PEDS TALK
fitnesspeptidesbodybuildinggym
Description

Looking for research-grade Tirz, Sema, Reta and others ? 🔬 Premium Quality You Can Trust

✅ Third-party tested with verified COA

🎁 FREE mixing solution with every order

🌍 Worldwide shipping – No membership required.

Today's activity
32
15
0
Server overview
566Total members
1years old
18Age requirement
The Spiritual Bodhi Cafe Discord server profile picture
The Spiritual Bodhi Cafe
weight losslose weightfitnessmounjaroozempic
Description

We are a SFW, 18+ weight loss server. We have all kinds of members, ranging from those on weight loss medications such as Mounjaro and Ozempic, to those who simply calorie count and practice mindful eating. Our goal is to be a place people look forward to visiting every day, somewhere they can share their struggles without judgement, and share their victories, no matter how big or small. To put it simply, this is a server for anyone who wants to lose weight safely and healthily. Whether you're just starting your journey, already finished and maintaining, or struggling to begin, you're welcome here.

Today's activity
116
18
0
Server overview
280Total members
2years old
18Age requirement
Description

BEST IPTV AND PLEX DEAL 2025

12,000+ Live TV Channels

30,000+ Movies on Demand

5,000+ Series on Demand

Worldwide Channels

30+ Countries Including - Sports , Ppv , boxing , ufc , premierleague , football , anime , games

UK , USA , CA , SPANISH , INDIAN 30+ Countries Including

➡️ PPV & All Sports and major leagues Include ➡️ Optional Adult Channels ➡️ No Blocks, No buffering, No VPN needed

➡️ All Device Supported Android Mobile & TV Apple Devices Firestick/Chromecast/Shield TV PC and Laptop

Today's activity
14
4
0
Server overview
1.8kTotal members
11months old
15Age requirement
Duck Entertainment Discord server profile picture
Duck Entertainment
plextviptvembymoviesfilmseries
Description

🎬 Duck Entertainment - Premium Plex/Emby Share/Appboxes | 40K+ Movies | 400K+ Shows | 50K+ Anime | Bollywood [50% OFF ] 🎯  USE CODE Facebook 50% off 🔥 SPECIAL OFFER: 50% OFF for This week only code in the discord, located in the promo channel. 🔗 Join our Discord: http://discord.ducktv.ing Direct link to buy  https://shop.iduck.xyz/plex-emby-shares

Code is reddit Library Highlights: * 30,000+ Movies  * Growing 4K Library (20% of total movies & TV)  * 330,000+ TV Episodes  * 50,000+ Anime content  * XXX standard  * Hindi Bollywood  * Audio Books 330k * Music 3k Artist/ 1k Albums/ 30k Tracks add on  * Constantly updated with latest releases  Technical Specs: * 150Gbps connection  * 2.9PB+ of Ceph storage  * Global CDN for optimal streaming  * Transcoding enabled (except 4K content)  * Local storage  * 2 concurrent streams standard for tv  * Emby support available  * Live tv available  Features: * Trakt integration  * Custom collections  * Curated libraries (Trending, Popular, Holiday specials)  * Request system with bot  * Regular updates with new releases  * High-quality encodes  * App boxes available  * instant automated checkout  Support: * 24/7 via Discord, WhatsApp, Email  * Try before you buy available!  Payment Options: * PayPal  * Crypto  * Flexible plans (Monthly/Quarterly/Yearly)  * Bundle with tv and save  🔗 Join our Discord: https://discord.ducktv.ing Want to test drive our service? Join Discord for a trial! Questions? Drop them below! 👇 Note: Limited time offer, grab your spot while it lasts!
#Quality #Reliability #PremiumContent #Plexshare #Embyshare #Plexappboxes

Today's activity
150
16
0
Server overview
4.1kTotal members
5years old
13Age requirement
FlyCow Games - Cow Club Discord server profile picture
FlyCow Games - Cow Club
brickbreakerskillzbrick breakerbrick blastercashplay to earn
Description

Play to Earn! Brick Blaster is a 80s style mobile arcade game with sweet techno soundtracks and awesome explosions. It's a competitive game based on the Skillz platform, so you can win and earn $ if you compete in cash tournaments. Download for iOS, Android APK, or Samsung here: https://games.skillz.com/game/22815

Today's activity
806
16
0
Server overview
463Total members
2years old
18Age requirement
Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang Discord server profile picture
Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang
communitysocialchillgamingroleplaygameshangoutfriendsfunfriendlychatmusicactiveminecraftrobloxrpfortnitegiveawaysprogrammingvalorantenglishchattingyoutubenitrolanguagediscordlearningminecraft-servergiveawayminecraft-javaespañolpcpokemongaming-communitywelcomingsupportvoice chatserveractive-communitytradingrobuxcryptospanishfrencheuropepvpnewsgamerspromotradehacksamericacryptosignalsbitcoindaytraderkemeticgermangermanymetin2yangbuym2tradecentermetin2tradermetin2pvpmetin2wonbuymetin2yangbuysmetin2yangbuygermaniametin2yangbuyiberiametin2metin2tradecenterm2trademetin2yangbuyeuropemetin2yangbuyitaliamt2trademetin2tradeusdtmetin2yangmetin2germaniawonbuymetin2teutoniawonbuymetin2teutoniayangbuymetin2teutoniayangkaufenmetin2teutoniawonkaufenmetin2 europe yang buymetin2 europe yangmetin2 italia yang buymetin2 iberia yang buymetin2 tigerghotmetin2 tigerghost yang buymetin2 tigerghost won buymetin2 tigerghost yang kaufenmetin2 tigerghost won kaufenanimemetin2 romania yang buymetin2 romania won buymetin2 ruby kirin won buymetin2 ruby kirin yang buymetin2tr yang satinalmetin2tr won satinalmetin2tr yangmetin2pvp yang satinalmetin2pvp yang buymetin2pvp won buy
user profile pic
metin2.yang13-05-2026 00:53

hi

user profile pic
guardwon13-05-2026 00:56

Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang! Metin2 Global/Official Won/YANG FAST DELIVERY Safe Trade Discord Add : metin2yang 👽-;----FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #Metin2 won buy #Metin2 won farming #buy Metin2 won #Metin2 won guide #how to buy won #Metin2 won tips #Metin2 won making #Metin2 won selling #cheap Metin2 won #Metin2 won tutorial #Metin2 won scams #Metin2 won market #Metin2 won tricks #Metin2 won 2025 #Metin2 won s

Description

Metin2TradeCenter Group 2027 Won/YANG FAST DELIVERY Safe TradeDiscord Add : metin2yang 👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #wonbuy #wonsell #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #metin2yangbuy #dragoncoins #Metin2yangkaufen #sell #metin2tradecenter #buy #tradecenter Metin2 Global/Official Won/YANG FAST DELIVERY Safe TradeDiscord Add : metin2yang👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #Metin2 won buy #Metin2 won farming #buy Metin2 won #Metin2 won guide #how to buy won #Metin2 won tips #Metin2 won making #Metin2 won selling #cheap Metin2 won #Metin2 won tutorial #Metin2 won scams #Metin2 won market #Metin2 won tricks #Metin2 won 2025 #Metin2 won strategies #Metin2 won farming guide #Metin2 won leveling #best Metin2 won #Metin2 won offline shop #Metin2 won alchemy #RubyChimera #RubyKirin #Azrael #Tigerghost #Metin2pvp #Metin2pvm #Metin2p #Metin2.de #Metin2.ro #Metin2.en #Metin2it #Metin2.ru #Metin2.us #Metin2.uk #Metin2.pl #Metin2.cz #Metin2.hu #Metin2.ar #Metin2.ae #Metin2.ea #Metin2.es #Metin2.pt #Metin2.gb #Metin2.ar #Metin2.co #Metin2.co #Metin2.mc #Metin2.mx #Metin2.pe #Metin2.fr #Metin2.magyar #Metin2.br #Metin2.tr #Metin2tr #Metin2.germania #Metin2Teutonia #Metin2Europe #Metin2.eu #Metin2Marmara #Metin2.west #metin2west #Metin2Dandanakan #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter

Discord Add : metin2yang👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy Metin2Tradecenter Private-gameforge-official Won-YANG discord: metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #dragoncoin #metin2tradecenter #tradecenter #wonkuanfen #tigerghost #tigerghostwonbuy #mt2tradecenter #metin2

Today's activity
25
21
0
Server overview
2.2kTotal members
6months old
18Age requirement
Nexus. Discord server profile picture
Nexus.
business
Description

Nexus is an international business forum about entrepreneurship, investing, e-commerce and more.

Today's activity
33
5
0
Server overview
187Total members
6months old
13Age requirement
English Speaking Practice Discord server profile picture
English Speaking Practice
englishlanguagesocialcommunitylearningstudylanguageenglish practicechillhangoutfriendlysfwactive
Description

English Speaking Practice is a welcoming community dedicated to helping you improve your spoken English with confidence! 🌍✨ 💬 Practice speaking with people from around the world 🎮 Engage in fun activities like games and discussions 🎶 Share music, watch movies, and make new friends Join us to enhance your communication skills in a supportive and friendly environment.

Today's activity
12.6k
624
875
Server overview
111.0kTotal members
4years old
13Age requirement
Description

Forex & Crypto Trading Community

Today's activity
32
3
0
Server overview
185Total members
11months old
13Age requirement
DEVASTATION ONLINE Discord server profile picture
DEVASTATION ONLINE
gamingcommunity18+englishsocialwargamingfpsrtsarma reforgerbf6escape from tharkovwar thunderr6broken arrow
Description

Devastation Online is a non-profit wargaming and FPS community founded in 2004, built on teamwork, precision and camaraderie. We value diversity, maturity, inclusiveness, integrity. With over 200 members, we offer a social and grown-up environment for players aged 18 and above. Whether you need a break from work, family life, or simply want a place to hang out, Devastation Online is your community. With our dedicated content creator section, you can be sure that your in-game moments will be captured, shared and spotlighted across our social media platforms. "We dont die - We respawn"

Today's activity
40
12
2
Server overview
404Total members
6years old
18Age requirement
RL2K BOOST - Rocket League Discord server profile picture
RL2K BOOST - Rocket League
rocket leaguerocket league boostrocket league boostingrocket league accountsrl boostingrl accountsrocket league coachrl coachrl prolft rocket leaguerocket league serverrocket league duorocket league friendsrocket league professional
Description

🚀High rank solo boost services! Duo Queue, Coach. 🚀Team with a lot of experience with boosting, can boost you in all modes, ssl ranks, tournaments and gc all modes. ✅We have completed over 700 orders ✅Looking to share my knowledge and skills about the game. I have to much experience on that game and played more than 10000 hours. Have 100% good feedback after services ✅24/7 online customer service!

Today's activity
12
12
0
Server overview
918Total members
4years old
13Age requirement
UFOlogy Discord server profile picture
UFOlogy
chatpoliticssciencereligionspaceparanormalmilitaryghostsgoduniverseplanesuapbeliefsaircraftaliensufoastronomy
Description

➢ Serious discussion about UFOs, UAPs and Extraterrestrial Life

Today's activity
553
15
2
Server overview
1.2kTotal members
3years old
13Age requirement
Swole Spergers Discord server profile picture
Swole Spergers
liftingfitaspergershealthnutritionfitness
Description

Lifting

Today's activity
72
11
0
Server overview
77Total members
3years old
18Age requirement
Peptides Nexus Discord server profile picture
Peptides Nexus
peptidespeptidesfitnessgymweightloss
Description

Peptide Nexus is a professional community dedicated to peptide research, education, and scientific discussion. Our goal is to provide a welcoming environment where researchers, students, healthcare professionals, and science enthusiasts can explore the latest developments in peptide science and related fields.

Within our community, members can engage in meaningful discussions about peptide research, laboratory practices, scientific literature, biotechnology, and emerging innovations. We encourage the sharing of knowledge, peer-to-peer learning, and respectful conversations based on credible scientific information.

Peptide Nexus also provides dedicated spaces for research updates, educational resources, frequently asked questions, and community support. Whether you are new to peptide research or have years of experience, you'll find opportunities to learn, ask questions, and connect with like-minded individuals who share an interest in advancing scientific understanding.

Our server values professionalism, integrity, and evidence-based discussion. Members are expected to follow community guidelines, respect one another, and contribute positively to the community. We do not tolerate harassment, misinformation, or spam.

Join Peptide Nexus to become part of a growing network committed to expanding knowledge, encouraging collaboration, and promoting responsible scientific conversations about peptides and related research.

Today's activity
10
6
0
Server overview
52Total members
5months old
18Age requirement
Puella Magi: Maeror Magica Discord server profile picture
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
45
6
0
Server overview
168Total members
4years old
15Age requirement
Description

🌟 Welcome to Nexus AI 🌟

Your go-to platform for AI-powered APIs and tools. Access cutting-edge artificial intelligence technology for your projects.

🤖 AI APIs & Models(+17 models)
🔑 Secure API Keys
📊 User Dashboard
💎 100% Free(500 daily uses) It resets every 24 hours.
🚀Free Forever
👥 Developer Community
🎯 Technical Support

From chatbots to AI utilities, we've got you covered. Start building with AI today!

Today's activity
20
4
0
Server overview
241Total members
8months old
13Age requirement

311 servers found