Rp Discord servers

213 servers found

server profile pic
Mega Man X: Sirens in the Distance
mega manmegamanmega man xmegaman xroleplay
Description

Sirens in the Distance is a 20+ roleplay server, set in the Mega Man X timeline. We are a living and evolving alternate universe, giving players opportunities to introduce their own stories and expand on the MMX lore. We offer a mature, sandbox-style setting, with multiple open-ended plots, allowing players to meaningfully change the course of the Maverick Wars. We are new player-friendly! Prior knowledge of the MMX setting is not required. Canons, OCs and fangame characters are welcome! So come check us out!

Today's activity
198💬
25🟢
9👥
0📞
Server overview
54👥Total members
1📅years old
18+Age requirement
server profile pic
|| JJK || The Jujutsu Experience
jjkjjk roleplayjjk rpjujutsu kaisenjujutsu kaisen roleplayjujutsu kaisen rproleplay
user profile pic
gumeybear2122-09-2024 13:04

a

Description

The Jujutsu Experience! It's a roleplaying/hangout JJK server!! Your oc's make the future! It's simple and an up n' coming server. - Cannon Techniques to be claimed by YOUR ocs ;o - Friendly staff (I think I'm friendly anyways) - Easy to understand templates - Sukuna's vessel up for grabs >:)) So why don't you come on down and join! Even if you just want to hangout and chat, that's what we're here for, but if you want to rp, come make an oc that'll shape the lore of the server!

Today's activity
6.9k💬
62🟢
51👥
11📞
Server overview
155👥Total members
11📅months old
13+Age requirement
server profile pic
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
612💬
47🟢
24👥
0📞
Server overview
215👥Total members
2📅years old
13+Age requirement
server profile pic
𝗗𝟰
communitysocialchillroleplaygaminganimehangoutgamesfriendsfunfriendlyartmusicchatsfwvcactiveminecraftrobloxmangamemesmoviesrpfortniteeventsvalorantcreativeprogramminggtaweedequalitysmoking420amongusstoner
Description

● 𝐀 𝐂𝐎𝐌𝐌𝐔𝐍𝐈𝐓𝐘 𝐃𝐄𝐒𝐈𝐆𝐍𝐄𝐃 𝐅𝐎𝐑
┃ WEEBS
┃ GAMERS
┃ STONERS
┃ SKATERS
┃ ARTISTS
┃ HIPPIES
┃ EQUALITY
┃ ATHLETES
┃ MUSICIANS
┃ PROGRAMMERS
┃ MOVIE NIGHTS
┃ CONTENT CREATORS
┃ FREEDOM OF ┃EXPRESSION
● 𝗛𝗘𝗥𝗘 𝗔𝗧 𝗗𝟰 𝗪𝗘 𝗛𝗔𝗖𝗞 𝗣𝗘𝗗𝗢𝗦

Today's activity
1.6k💬
88🟢
23👥
3📞
Server overview
266👥Total members
3📅months old
13+Age requirement
server profile pic
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
3.2k💬
724🟢
114👥
14📞
Server overview
4.5k👥Total members
4📅years old
13+Age requirement
server profile pic
city in the sky · fluffy tag
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
15.4k💬
311🟢
117👥
8📞
Server overview
2.2k👥Total members
8📅months old
13+Age requirement
server profile pic
Rus' | Into The Frost
adventurefantasymedievalroleplay
Description

With a long winter preparing to encapsulate the Tsardom of Rus' and all living things within the Russkaya Zemlya, we invite you to join us in the new and improved Rus' Universe. Dobro pozhalovat' v Rus! Welcome to the Rus', my friend. The "Rus' | Into The Frost" is a server based on 15th-Century Medieval Russia with a fantasy twist. Imagine a world where legendary creatures found in traditional folklore coexisted alongside ManKind. It is in our universe that adventurers from all corners of the globe travel to the Land of the Rus' to test their mettle against the ferocious beasts that dominate the cold lands. Limited by only your own brilliant creativity, you are allowed to start off as a majestic and nimble Kitsune from the Far East—using magic to turn your foes to dust. You can even try to slay beasts as an Elven Archer from the Germanic Region who can strike down their prey from miles away, a werewolf, vampire, orc, and so much more. Don't be afraid to strive for whatever your artistic mind desires. This is a community that accepts all passionate to write, role-play, and help build an immersive universe influenced by its members and everything we do as a community. Upon joining, we ask that you take the time to read the instructions provided in our welcome channel. We are a very well-written and fleshed-out server. We hope that you'll be joining us very soon on our courageous adventures, friend.

Today's activity
150💬
19🟢
7👥
0📞
Server overview
41👥Total members
2📅years old
18+Age requirement
server profile pic
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
749💬
2.1k🟢
35👥
7📞
Server overview
12.3k👥Total members
8📅years old
13+Age requirement
server profile pic
RP n’ Chill
role-playroleplay
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
417💬
173🟢
49👥
1📞
Server overview
1.1k👥Total members
4📅years old
15+Age requirement
server profile pic
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
464💬
82🟢
23👥
2📞
Server overview
296👥Total members
3📅years old
16+Age requirement
server profile pic
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
2.4k💬
39🟢
27👥
5📞
Server overview
116👥Total members
1📅years old
14+Age requirement
server profile pic
Dragon Ball Finality
roleplaydragon balldbzdbcommunityvoice
Description

Dragon Ball Finality is a server dedicated to a roleplay set a few hundred years before the original Dragon Ball series began. Players are given the freedom to roleplay their own characters and pursue their own stories with a supportive and fun-loving community.

Today's activity
1.0k💬
15🟢
12👥
0📞
Server overview
27👥Total members
1📅months old
18+Age requirement
server profile pic
Bakugan: Infinite Dimensions
bakuganbakugan battle brawlerspokemonroleplayyugioh
Description

Welcome to the world of Bakugan! This server is the perfect hangout spot for Bakugan fans and collectors all over the world. We have an optional roleplay that welcomes the use of OCs that takes place in an alternate timeline from the legacy anime series. You can expect: A helpful, supportive and inclusive group of people, Active members, Kind moderators who dont abuse power, Space to share your collections and memories, Opportunity to meet new people and make lasting friendships, Several bots to play with, and an optional semi-literate rp experience with a unique story and antagonist, the ability to create your own OCs, cards and bakugan, with fair and balanced game rules with a level up system based on the video game!

Today's activity
81💬
79🟢
10👥
0📞
Server overview
426👥Total members
3📅years old
13+Age requirement
server profile pic
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
360💬
155🟢
33👥
9📞
Server overview
1.2k👥Total members
2📅years old
13+Age requirement
server profile pic
𝙏𝙤𝙮 𝙏𝙤𝙬𝙣
plushroleplaycommunitytupperboxtoycozy
Description

Board the train to a town unlike any other... A town where soft and cuddly plushies and squeaky pooltoys can hang out! A town where the toughest of action figures can spring into action and show themselves off for all the dolls to see! Whatever you are, We're sure Toy Town has something for any and everyone! So what are you waiting for? Come join us!

Today's activity
5💬
20🟢
4👥
0📞
Server overview
64👥Total members
1📅years old
13+Age requirement
server profile pic
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
267💬
32🟢
11👥
0📞
Server overview
125👥Total members
4📅years old
15+Age requirement
Description

A pretty chill Kirby Roleplay server. Just follow the rules and you’ll have fun. We’re currently a small server and we hope to see you join

Today's activity
106💬
18🟢
6👥
0📞
Server overview
38👥Total members
4📅months old
13+Age requirement
Description

# __Welcome to the Kingdom of Valceto__
A fairly small kingdom located in northern europe, close to rome and or modern Italy. This is a text roleplay that takes place in the year 1090!. Fantasy!!

*" As the days go on rumor starts to spread about a corpse being found within the palace grounds. People speculate that it was some freak accident, or perhaps a murder? The answers varied from person to person, though no one knew what to believe. They were just rumors after all, right?

Weeks went by and more people have gone missing. Suspicions begin to rise as to who—or—what is causing these disappearances. However, the king has been very adamant about keeping people's mouths shut. "*

Today's activity
47💬
10🟢
6👥
0📞
Server overview
29👥Total members
11📅months old
13+Age requirement
server profile pic
Tales of Ideals
roleplaysuperherosuperheroes
user profile pic
the_sigg02-09-2024 13:23

Testing!

user profile pic
the_sigg02-09-2024 13:24

Hey there, get in!

Description

***For as long as humans have dreamed, we have dreamed of heroes.*** ***What if these dreams could come true? Could the world handle such power?*** ***These are...*** # _ _ _ _ 『 𝕋𝕒𝕝𝕖𝕤 𝕠𝕗 𝕀𝕕𝕖𝕒𝕝𝕤 』 _ _ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ Set in an alternate history version of our world, __**Tales of Ideals**__ tells the story of a world where superheroes have gone all but extinct. Following the destruction of much of civilization, society has lost faith in its protectors. In the United States, those that remain are under the watch of the **Superhuman Public Response** team. Now, in the year 2024, the balance of the world is in the hands of a new age of superheroes. Stagnant for decades, it is finally time for them to rise up again... but will they succeed? Will crime and villainy prevail at last? Or will this age die out before it gets going, and force the world to recover without supers? ### *The future is up to you!* _ _ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ## 𝓕𝓔𝓐𝓣𝓤𝓡𝓘𝓝𝓖: 💥 A world with decades of alternate history to discover! 🌎 Over **60** channels to roleplay in! 👊 The ability to create your own superheroes (or villains!) 🔥 A narrative focused approach, with an evolving world! ⚡ A class- & archetype-based system of character growth!

Today's activity
11💬
13🟢
7👥
0📞
Server overview
46👥Total members
1📅years old
18+Age requirement
server profile pic
Sauce
socialcommunitychillroleplaygamesanimefriendsactivemoviesegirlfreakyactive-voicechatdatingedating
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
450💬
129🟢
29👥
3📞
Server overview
1.1k👥Total members
7📅months old
13+Age requirement
server profile pic
The Democratic Server of Kaeska
political roleplaypoliticschattingroleplay
Description

The Democratic Server of Kaeska is a place where YOU can take charge. Create or join the political parties of your dreams. Run for President. Create laws. Vote on issues. Win the hearts of your fellow servermates. Created and moderated by an experienced team of people, we feature a custom discord bot, and a thriving community. Will Kaeska be the perfect utopia? Or will you run it into the ground? The choice is YOURS. Welcome to the Democratic Server of Kaeska.

Today's activity
76💬
22🟢
9👥
0📞
Server overview
108👥Total members
8📅months old
13+Age requirement
server profile pic
Avalon Community Servers
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
74💬
100🟢
12👥
0📞
Server overview
978👥Total members
8📅years old
13+Age requirement
Description

"You'll face death, and it won't be pretty.
Enough death to leave your broken, time and time again...."

Congratulations! The application you submitted to become a part of Project Epsilon has been accepted! Welcome aboard!

Hello and a warm welcome to Halo: Project Epsilon! This is a server where you take the role as an agent of Epsilon. You will embark on a whole variety of missions to various ancient and fantastical planets (created by yours truly) to combat the rising power of the evil Red Talon corporation. While working alone in this server is plausible, it is also foolish. We here at Epsilon are huge advocates for teamwork as it not only improves overall RP experience, but it also leads to more interesting and diverse scenarios for you and your new friends to enjoy. You heard me right, friends! Epsilon gladly welcomes anyone of any race, culture, background or identity, regardless of whether or not you are a member of the LGBTQ+ or if you are just an 8ft tall Sangheili, we are all friends here!

This is based on Red VS Blue’s project freelancer and is a custom rp server that involves:
- Team based mission RP 🕴️
- A competitive leaderboard to flex on all your pals 💪
- Frequent and inclusive events (nitro) 🫨
- Friendly staff who will be your new best friends 😎
- Acceptance of everyone, unless you are from Formby, which case I want my money back 🏳️‍🌈
- POKECORD 🦆
- Comedy 🤓
- Women (I think)🤷
- HUNGER GAMES! 🕺
- CQ Cumber 🐐
So if you like what I described and you think this server fits your vibe. Join! I would love to see you there and so would everyone else. If you still have any questions then all you got to do is ask me or our dedicated staff team (I love them) who will gladly offer assistance to solve any quibbles and quabbles you may have. I truly hope to see you there.

-Colorado

Today's activity
55💬
27🟢
7👥
0📞
Server overview
139👥Total members
5📅years old
13+Age requirement
server profile pic
The Lorin Sector: A 40K RP
000character rproleplaywarhammerwarhammer 40
user profile pic
warmind_d409-01-2024 16:20

.

user profile pic
caliph333309-01-2024 08:18

AAAAAAAAAAAAAAA

user profile pic
caliph333310-12-2023 19:34

Join it NOW

Description

The Lorin Sector is an Imperial Sector in the Eastern Fringes caught between the T’au Empire, Realm of Ultramar, the Exodite Worlds, the Jericho Reach, and the Scourge Stars. This territory represents a rugged frontier of Imperial Space, having been far gone ever since the Cracks within Imperial Authority during the Nova Terra Interregnum. Fairly isolated from the million-strong armies and mighty Battlefleets of the Imperial Heartland, it is a Sector that is ultimately blessed by its positioning, yet must always fend for itself against the threats creeping in. May it be Genestealer Cults, Xenos Races, Warp Spawn and their Mortal Followers, Redemptionists, or even Dark Ancient Forces beyond all of them. This Warhammer Roleplay is generally based around relative freedom to play what you desire. Although we somewhat focus on playing various Warlords of different factions, we generally try and offer options for character campaigns and the like. We have a relative large staff that is friendly and will attempt to help others in need. Feel free to hop in!

Today's activity
50💬
104🟢
13👥
0📞
Server overview
336👥Total members
1📅years old
15+Age requirement
server profile pic
Nocturnal RP
communityroleplayinggta5rpfivemgaming
Description

🌌 NOCTURNAL RP 🌌
✨ Where every choice is a story…

🔒 Whitelist Serious RP
🚧 BETA Phase Live – Now Accepting Testers!
🎭 Crime • Business • Law • Endless Possibilities
👥 Community Input Welcome – Help shape the future!

⸻⸻⸻⸻

💥 HIGH-STAKES ROLEPLAY
• Pull heists, lead gangs, build criminal empires
• Craft your story from street rat to kingpin
• Fully dynamic drug & black market systems

🚓 SERIOUS PD & LAW ENFORCEMENT
• Climb the ranks of a realistic, structured police force
• Build detailed cases, raid hideouts, and run investigations
• Realistic MDT, dispatch, evidence, & courtroom systems
• Corruption or integrity — your path, your story

🏙️ IMMERSIVE CITY LIFE
• Custom businesses & ownership opportunities
• Advanced economy with player-run markets
• Jobs, crafting, housing, vehicles & more

🎉 BETA TESTING REWARDS!
• Top Testers (time spent & bug reports) = Special Launch Rewards
• Every Tester = Exclusive Beta Prize
• Early members still get exclusive roles & bonuses

👀 SNEAK PEEKS LIVE NOW!
• Preview scripts, interiors, factions, & systems
• Provide feedback that can help shape the city

💬 WE LISTEN TO OUR COMMUNITY
• Suggest ideas, report bugs, and shape policies
• Transparent devs who actually care



🖤 Built by RPers, for RPers
🌙 Join a serious community that values creativity, immersion, and FUN

⸻⸻⸻⸻

🎟️ Whitelist Required
🎮 Beta Testing Now Open
🔗 Join Now & Shape Your Legacy: https://discord.gg/6ha4eY9sbZ

🌃 Let your next chapter begin in Nocturnal RP.

Today's activity
37💬
38🟢
13👥
0📞
Server overview
105👥Total members
2📅months old
18+Age requirement
server profile pic
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
446💬
19🟢
14👥
0📞
Server overview
78👥Total members
11📅months old
16+Age requirement
Description

a good roleplay server with a gossip girl based lore!

Today's activity
37💬
50🟢
9👥
0📞
Server overview
325👥Total members
1📅years old
13+Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
2.5k💬
133🟢
32👥
2📞
Server overview
638👥Total members
5📅years old
14+Age requirement
server profile pic
Øm̷n̷ɨvɇɍs̷a̷ł Ȼøłłɨs̷ɨøn̷
crossovermultiversemultiverse rproleplayroleplay crossover
Description

Somehow, World after World, it went black, straight after, characters from other worlds collided with a new world. These versions however, are unstable. Yet no one but the Vessels knew. A group who knows the real truth, and want to fix it. They believe there isn't much they can do, but maybe You can change that.

- Become a Vessel, a Citizen, A king. All roles are needed and can be played as much as possible.

- Participate as the main cast, or just roleplay for fun here.

- Fight or Help others, your free to choose.

- Explore around. Maybe you'll find a new place.

Hopefully you'll enjoy this server.

Today's activity
23💬
71🟢
12👥
0📞
Server overview
281👥Total members
1📅years old
15+Age requirement
server profile pic
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★
roleplaysocialcommunitychillanimehangoutcreativemangaliterateocbleachbleach rpbleach roleplayanime rpanime roleplaymanga rp
user profile pic
coolin.real15-11-2024 18:14

hi guys!

Description

[**``黒— ★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★``**] ***Join our server for an interesting run, an adventure throughout multiple different worlds and realms, a deeper perspective on several different races and untold stories in this entirely new world. You may fight strong opponents, take on new heights, push yourself beyond your limits and even face off against those above! With or without a purpose, be a an active participant in the lore of our server that revolves entirely on you all. Destroy the strongest hollows or even reapers, quincies, fullbringers, humans (hell anything you name it) this era has ever known or just simply do your own thing; Awaken a bankai, shoot arrows, become an espada or develop a mask! The opportunities are practically endless in this Mugetsu world! With several systems to guide your very actions and several people willing to rp with you where could things go wrong? immerse yourself in our very own Bleach universe, and interact with fellow fans. With engaging roleplay, thrilling storylines, and a welcoming community, this server is the ultimate destination for fans of all ages. Don't miss out on the chance to explore the vast world of Bleach and create unforgettable memories with like-minded enthusiasts. Join now and let’s start up this journey today, Karakura town is awaiting you!*** **Our own unique take on Bleach, you took the time to read this far so we KNOW you’re interested!** **``We offer: A forum based oc submission system where we can easily interact with you and point out certain details Several different templates for multiple different things such as weaponry, zanpakuto, and the different races showcased in the anime/manga! An active staff team The chance to influence the story or have your own arcs Be part of the main cast! Everyone is really, I mean it! A multitude of different systems for important techniques and skills such as the transformations (such as bankai, shikai, training, resurrecion and mastery) A lot of channels that give background information on what you can do with the bleach power systems so even if you haven’t actually seen the series or read the manga you could read up for a basic understanding! The chance to utilise cool transformations, zanpakuto's, kido spells, or even create your own Influence a moving plot a money system a moving story and a chance to give your own two cents``** ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Links: https://discord.gg/uKK8Q3nggG [let's go, your journey starts now!](https://tenor.com/bQ7nQ.gif) Pings: ||@everyone @here||

Today's activity
22💬
92🟢
9👥
0📞
Server overview
539👥Total members
12📅months old
13+Age requirement
server profile pic
R&Dé
communityroleplayboard gamesfrance
user profile pic
.tzen17-09-2024 17:22

Bonsoir à tous !

user profile pic
.tzen18-09-2024 09:27

Le Monopoly c'est super (non)

Description

🎲 Bienvenue sur R&Dé ! C'est LA communauté qui rapproche joueurs passionnés et créateurs chevronnés. Rejoignez des conversations animées sur les derniers jeux, découvrez des stratégies, échangez des astuces et trouvez des partenaires pour des parties endiablées. Nous organisons régulièrement des soirées de jeu, de création, des tournois et des événements spéciaux comme des game jams. Entrez dans la famille ludique R&Dé ! Tous : • partagez vos coups de cœurs • découvrez des nouveautés • trouvez des compagnons de jeu • jouez ensemble • partagez des stratégies • accès exclusif à des prototypes originaux Créateurs : • bénéficiez du retour des joueurs • demandez des conseils • partagez vos expériences Ensemble, inventons les classiques de demain ! Suivez-nous sur les réseaux et partagez à vos amis joueurs : • Twitch https://www.twitch.tv/rdegames • X TBD • Facebook TBD • Youtube TBD • Discord https://discord.gg/CFutHdqjRh

Today's activity
16💬
15🟢
4👥
0📞
Server overview
193👥Total members
1📅years old
13+Age requirement
server profile pic
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
311💬
50🟢
15👥
0📞
Server overview
196👥Total members
2📅years old
13+Age requirement
server profile pic
AI Buddies
aianimechattingcommunitygirlsmangensfwroleplaysocial
Description

Looking for great AI conversations? Chat with top-notch AIs directly on Discord through PM Choose your favorite AI Buddy and start chatting! New AIs are added regularly, and they’re free to try

Today's activity
30💬
130🟢
29👥
0📞
Server overview
2.4k👥Total members
1📅years old
18+Age requirement
server profile pic
Wandering Paws
communitysocialroleplayfriendlychatrobloxrpcatslgbtqwarrior catswarrior cats roleplaywarrior cats rp
Description

Wandering Paws is a newly created roleplaying hub centered around hosting in-game short-term roleplays in Warrior Cats: Ultimate Edition. No long-term commitment required! All roleplay events are hosted in WCUE and we like to make sure that every roleplay is unique and entertaining. The best thing about Wandering Paws is that attendance is strictly based upon your availability! Our roleplays do not require everyone to be present, you are allowed to join and leave whenever you want to! Wandering Paws was designed with those who may not have time for ongoing, long-term roleplays but still crave fun and engaging roleplays in mind. Please keep in mind that our age requirement is 14 years old.

Today's activity
12💬
21🟢
2👥
0📞
Server overview
53👥Total members
5📅months old
14+Age requirement
server profile pic
Mirabilis: Fantasy RP
dndhomebrewroleplayfantasysfw
Description

"Your hopes and prayers are now useless. You cannot handle the power Lucifer is going to produce onto Mirabilis. We shall now reign hell and have everyone suffer damnation." - Count Xorgoth of the Underworld

Welcome to the Age of Damnation! It may seem like paradise, but... it's not what your eyes would seem...

Hey, nerd! Are you tired of fantasy roleplay number 500,728? Do you like nation roleplaying? What about Dunegon's & Dragons? If you said yes to ANY of these questions, Mirabilis is right for you! Here we host campaigns, discuss about OCs, have fun, chill and hangout, and most of all let our imaginations wander! Just in the palm of your hands.

What are we looking for?: Gamemasters, mappers, active members, you, staff, partners, and roleplayers.

Here's what we have to offer!

🥰 - A safe haven for everyone! Especially artists, the LGBTQIA+, furries, new roleplayers, and novella ones too!

🦊 - Many races to choose from! Humans? maybe fursona species? Something you probably don't know? We have it! And there's more to come!

⚔️ - Stuff such as arena mode, prophecies, events, and many things to keep you entertained!

👍 - SFW! Yes, your 13 year old brother could view this too!

🤔 - Tools to help you create something you want to submit! If you had a lightbulb, it would be shining after you get help.

😱 - An active and growing community! Care enough to contribute?

👾 - Campaigns hosted occasionally! Find some campaigns you want to focus on playing in!

Your journey to a good roleplay is a click/tap away! Give it a try! And I promise you won't regret it.

Today's activity
8💬
36🟢
2👥
0📞
Server overview
118👥Total members
1📅years old
13+Age requirement
server profile pic
" Hold On " !! Detroit Become Human RP
dbhdetroit become humanroleplaydbh rpcommunitygamehangoutrp
Description

𖦹ㅤ ̼ ₊ㅤㅤLOADING. . . ㅤ ۪ ֹ

Detroit 2038. Technology has evolved to a point where human-like androids are everywhere. They speak, move and behave like human beings, but they are only machines serving humans. Play three distinct androids and see a world at the brink of chaos – perhaps our future - through their eyes

>﹒Main characters. Funny thing to call people. The world doesn't have main characters. They are just people that suffer and those who cause pain.

A free will. Yes, that's what is causing pain and chaos. There's no "choose" option anymore. There are just people and their will.

Think wisely. Nothing happens without a reason . . .

. . .
. . . . . .

> LOADING FINISHED

> PROCESS TO CONTINUE?
> YES > NO


⊹ ⠀࣪⠀ㅤㅤ ㅤ OUR OFFERT. . . ִ
> many free cc
> helpful crew including admins and mods
> chance to write your own storyline
> oc friendly
> safe community
> semi-lit / literate community
↷﹒⇆﹒

Today's activity
5💬
34🟢
2👥
0📞
Server overview
119👥Total members
9📅months old
13+Age requirement
server profile pic
Oaths of Steel
roleplayroleplayinghouse of the dragongame of thrones
Description

🏰 Oaths of Steel | House of the Dragon RP 🐉

Enter the world of Westeros, where loyalties can shift like the wind and the bold carve their names into history.

🔥 Year 115 AC. The realm flourishes under the rule of Queen Vaelana Targaryen, First of Her Name. With dragons soaring above Westeros and noble houses vying for influence, the Iron Throne sits ever vulnerable to ambition, treachery, and blood.

Oaths of Steel is an immersive, literate roleplaying server set in the brutal and beautiful world of Game of Thrones / A Song of Ice and Fire (Set in the era of House of the Dragon). Whether you're a scheming noble in King’s Landing, a Night’s Watch ranger at the Wall, or a Knight claiming glory in battle — your story begins here.

🌐 What We Offer:

📜 Original Characters

🗺️ Detailed maps, custom lore channels, and deep worldbuilding.

⚔️ Political Intrigue & War

🐉 Player-driven plots with mod-run events and consequences.

🐺 All Houses Open (except Targaryen (for now!))

🕊️ LGBTQ+ friendly, 17+ community

🎭 Come if you love:

Deep character arcs

Strategic alliances & betrayal

Lore-rich fantasy settings

Join us. Swear your oath. Shape the realm.

"The game is yours to play — and the price is yours to pay."

Today's activity
4💬
16🟢
3👥
0📞
Server overview
18👥Total members
2📅years old
17+Age requirement
server profile pic
TateWorld
roleplayanimemangarpjjkanime rpjujutsu kaisenjjk rpanime roleplayjujutsu kaisen roleplayjjk roleplayjujutsu kaisen rpmanga rpanime mangamanga roleplay
Description

𝐽𝑈𝐽𝑈𝑇𝑆𝑈 𝑆𝑂𝑈𝑆𝐸𝑁 | 𝐾𝑂𝐷𝐴𝐼 𝑁𝑂 𝐹𝑈𝐾𝐾𝐴𝑇𝑆𝑈
⇢ No stat system, no starting off at the weakest you could possibly be, and both the ability to grow IRP, and not have to deal with overbearing restrictions that mess up your character's narrative, while doing so! Why aren't there many? Because OCs make the story here, and every. single. RP. contributes to the plot directly. Now, on to the actual ad...

⇢ Time comes for us all, no doubt, but death 𝘥𝘰𝘦𝘴 wait.

⇢ The world of jujutsu will never be the same again, not after 𝙩𝙝𝙞𝙨... because 𝙚𝙫𝙚𝙧𝙮𝙩𝙝𝙞𝙣𝙜 is on the brink of changing forever. The turn of the first millenium draws near, and... so much has been lost. The age old war between man and curse has reached its peak, unspeakable evils have been unleashed, and no man, woman or child in Japan has been spared from the consequences. This is the height of the Heian era, what will you do?

Today's activity
3💬
33🟢
3👥
0📞
Server overview
72👥Total members
3📅months old
13+Age requirement
Description

***TOKYO GHOUL - TRIBUTES***

*This server is 16+!*
It is modern day Tokyo. Years have passed since the Dragon War. Faux allyships between Ghoul and Mankind have crumbled like castles under poor leadership and glorified silver linings. From the ashes rose tired, angry, and vengeful ghouls that were given fragile promises and hope at living a normal life.

The United Front and newly-instated CCG, lead by Matsuri Washuu, are now at war. The CCG believes that it is their rightful title as Japan's proper justice division and that all ghouls must be executed as a means to prevent a third-wave’s occurrence as well as another Dragon Incident. The wards have been distorted in chaos underneath the surface, as constant warring over Tokyo's wards appears to be never-ending.

The strange world just got stranger. The dead are mysteriously rising, old organizations are returning with new faces and new leadership, and the ghoul and human worlds as we know it are headed for significant changes.

Here there is a very lax ranking system, meaning that, until the free-spots are filled for higher ranking ghouls / investigators you may have to have your character be higher ranked. For those that miss out, do not fret. We are solely-activity based, meaning the longer / more active you are the higher the rank you can become via the Arcane bot level system **in roleplay channels only**. Both canons and original characters are welcome. Create your own paths - your lore is incorporated into the server's lore. Have fun and enjoy your stay!

*What we offer*

- Unlimited OCs
- A complete, unique server with all 24 wards and location channels within them
- Semi-lit - Adv. Lit RP
- A small but growing community of friendly, creative people
- Canon Character roles
- Gartic, music bots and streaming voice chats

Today's activity
3💬
27🟢
2👥
0📞
Server overview
70👥Total members
1📅years old
16+Age requirement
server profile pic
Star Wars: Thrawn's Resurgence
roleplaystar warsstar wars rp
Description

```Welcome to Star Wars: Thrawn's Resurgence – an immersive journey that unfolds during the gripping events of Ahsoka. Ahsoka and Sabien tirelessly searching for the enigmatic Ezra Bridger and the formidable Grand Admiral Thrawn. Their relentless pursuit will lead to an electrifying showdown on the enigmatic world of Seatos.

Join the action-packed battle where Baylan Skoll, Shin Hati, Marokk, and Elsbeth stand in the way of our heroes. As alliances are forged and destinies entwine, the fate of the galaxy hangs in the balance. The confrontation at the Seatos battlefield will leave you on the edge of your seat as Baylan and Ahsoka lock horns amidst the chaos.

The story doesn't stop there – it's just the beginning. Prepare to embark on an unprecedented adventure as Ahsoka, her allies, and her foes venture into the uncharted depths of the Unknown Regions, all in pursuit of the enigmatic Thrawn.

The pivotal choice lies in your hands: Will you join the brave rebellion against Thrawn's looming shadow, or will you aid the enigmatic Grand Admiral in his quest for power? The outcome is yours to shape, and the galaxy's destiny is at stake.

May the Force guide you as you step into the Star Wars universe and experience a narrative that can evolve in countless ways. Good luck, and may you find your path in the galaxy far, far away!```

Today's activity
3💬
5🟢
1👥
0📞
Server overview
8👥Total members
2📅years old
13+Age requirement
Description

✟ 𝐖𝐞𝐥𝐜𝐨𝐦𝐞 𝐁𝐢𝐭𝐜𝐡𝐞𝐬, 𝐁𝐫𝐨𝐬 𝐚𝐧𝐝 𝐍𝐨𝐧 𝐁𝐢𝐧𝐚𝐫𝐲 𝐇𝐨𝐞𝐬 𝐭𝐨 𝕾𝖎𝖓𝖓𝖊𝖗𝖘 𝕻𝖆𝖗𝖆𝖉𝖎𝖘𝖊, 𝐚 𝐥𝐢𝐭𝐞𝐫𝐚𝐥 𝐡𝐞𝐥𝐥 𝐡𝐨𝐥𝐞 𝐨𝐟 𝐝𝐞𝐬𝐭𝐫𝐮𝐜𝐭𝐢𝐨𝐧 𝐚𝐧𝐝 𝐦𝐚𝐲𝐡𝐞𝐦, 𝐚 𝐩𝐥𝐚𝐜𝐞 𝐰𝐡𝐞𝐫𝐞 𝐯𝐢𝐨𝐥𝐞𝐧𝐜𝐞 𝐢𝐬 𝐧𝐞𝐱𝐭 𝐝𝐨𝐨𝐫 𝐚𝐧𝐝 𝐚𝐫𝐬𝐨𝐧 𝐢𝐬 𝐨𝐧 𝐞𝐯𝐞𝐫𝐲𝐨𝐧𝐞'𝐬 𝐦𝐢𝐧𝐝, 𝐛𝐮𝐭 𝐡𝐞𝐲 𝐢𝐭'𝐬 𝐚𝐧𝐨𝐭𝐡𝐞𝐫 𝐝𝐚𝐲 𝐢𝐧 𝐡𝐞𝐥𝐥 𝐚𝐢𝐧'𝐭 𝐢𝐭, 𝐚𝐧𝐲𝐠𝐚𝐲𝐬 𝐭𝐡𝐢𝐬 𝐬𝐞𝐫𝐯𝐞𝐫 𝐢𝐬 𝐚 𝐩𝐥𝐚𝐜𝐞 𝐰𝐡𝐞𝐫𝐞 𝐲𝐨𝐮 𝐜𝐚𝐧 𝐫𝐨𝐥𝐞𝐩𝐥𝐚𝐲 𝐚𝐬 𝐲𝐨𝐮𝐫 𝐟𝐚𝐯𝐨𝐫𝐢𝐭𝐞 𝐜𝐡𝐚𝐫𝐚𝐜𝐭𝐞𝐫𝐬 𝐟𝐫𝐨𝐦 𝐇𝐚𝐳𝐛𝐢𝐧 𝐇𝐨𝐭𝐞𝐥 𝐚𝐧𝐝 𝐇𝐞𝐥𝐥𝐮𝐯𝐚 𝐁𝐨𝐬𝐬, 𝐈𝐓 𝐈𝐒 𝐀 𝟏𝟔+ 𝐒𝐄𝐑𝐕𝐄𝐑 𝐬𝐨 𝐚𝐥𝐥 𝐲𝐨𝐮 𝐦𝐢𝐧𝐨𝐫𝐬 𝐰𝐡𝐨 𝐭𝐡𝐢𝐧𝐤 𝐲𝐨𝐮 𝐜𝐚𝐧 𝐬𝐭𝐢𝐜𝐤 𝐲𝐨𝐮𝐫 𝐡𝐞𝐚𝐝 𝐚𝐫𝐨𝐮𝐧𝐝 𝐡𝐞𝐫𝐞 𝐛𝐞𝐭𝐭𝐞𝐫 𝐭𝐡𝐢𝐧𝐤 𝐭𝐰𝐢𝐜𝐞, 𝐲𝐞𝐚𝐡 𝐭𝐨 𝐦𝐚𝐤𝐞 𝐭𝐡𝐢𝐬 𝐥𝐢𝐭𝐞𝐫𝐚𝐥 𝐡𝐞𝐚𝐭 𝐡𝐨𝐥𝐞 𝐜𝐨𝐨𝐥𝐞𝐫, 𝐰𝐞 𝐡𝐚𝐯𝐞 𝐜𝐚𝐧𝐨𝐧 𝐜𝐡𝐚𝐫𝐚𝐜𝐭𝐞𝐫'𝐬 𝐚𝐧𝐝 𝐞𝐧𝐜𝐨𝐮𝐫𝐚𝐠𝐞 𝐎𝐂𝐬, 𝐬𝐨 𝐲𝐚𝐥𝐥 𝐛𝐞𝐭𝐭𝐞𝐫 𝐬𝐭𝐚𝐫𝐭 𝐠𝐞𝐭𝐭𝐢𝐧𝐠 𝐜𝐫𝐞𝐚𝐭𝐢𝐯𝐞 ✟

Today's activity
2💬
24🟢
2👥
0📞
Server overview
56👥Total members
2📅years old
16+Age requirement
server profile pic
Ridgeford Isles RP
roleplayzombie-rppost-apocalypticpost-apocalypseapocalypse-rp
user profile pic
teralive.01-12-2023 14:04

boo

Description

welcome to ridgeford! a small american town located off the northwest coast of the US. you're a survivor, and find the island has been left in ruin after an apocalypse has swept the nation. it is up to you - as one of the lone survivors - to uncover the mysteries behind this island; and the source of the so called angels that ravage it.

Today's activity
2💬
6🟢
1👥
0📞
Server overview
8👥Total members
1📅years old
15+Age requirement
Description

[QUICK DISCLAIMER: This is a ROLEPLAY server. If you are here to trade, do not join.] 2 worlds exist, the human world, and the Yo Kai World. They used to be separate, but some time, long ago in the past, their borders got hazy and Yo-Kai started to pour in, and cause all sorts of troubles for humans! Completely invisible to the human eye, they inspirit people and cause problems ranging from the mild annoyance to major danger. Luckily, a device exists to allow humans to see and even befriend the Yo-Kai! Can a peace be reached between the 2 worlds, or is an unseen catastrophe right on the horizon?

Today's activity
2💬
51🟢
2👥
0📞
Server overview
239👥Total members
4📅years old
13+Age requirement
server profile pic
A Helluva Fire and Heavens Glow
roleplaylgbtq+literaterpcreativesemi-literatehazbin hotelnovellahelluva bosssemi-lithellhelluvahazbin hotel rphazbinhelluva boss rp
Description

✧ 𝐀 𝐇𝐞𝐥𝐥𝐮𝐯𝐚 𝐅𝐢𝐫𝐞 𝐚𝐧𝐝 𝐇𝐞𝐚𝐯𝐞𝐧’𝐬 𝐆𝐥𝐨𝐰 ✧ Hey there, wayward sinner. Are you a fan of Hazbin Hotel or Helluva Boss? Do you enjoy diving into rich, character-driven roleplay? Then welcome aboard. This is a roleplay server inspired by Vivziepop’s creations—Hazbin Hotel and Helluva Boss—with a focus on detailed storytelling, strong character arcs, and a community that thrives on creativity. ✧. ┊  𝘛𝘩𝘪𝘴 𝘪𝘴 𝘢 𝘭𝘰𝘳𝘦-𝘩𝘦𝘢𝘷𝘺, 𝘭𝘰𝘳𝘦-𝘧𝘰𝘤𝘶𝘴𝘦𝘥 𝘴𝘦𝘳𝘷𝘦𝘳 𝘣𝘶𝘪𝘭𝘵 𝘧𝘰𝘳 𝘴𝘵𝘰𝘳𝘺𝘵𝘦𝘭𝘭𝘦𝘳𝘴. ┊.✧ ✧ 𝗪𝗛𝗔𝗧 𝗬𝗢𝗨 𝗖𝗔𝗡 𝗘𝗫𝗣𝗘𝗖𝗧 ✧ ★ — A variety of channels to explore, both IC and OOC ★ — Fun, multipurpose bots to enhance your RP experience ★ — Required, in-depth character templates to help shape your creations ★ — An active, reliable staff team that’s here for you ★ — Semi-lit to novella styled writers welcome ★ — Simple, clean server layout ★ — 18+ server | ID verification is mandatory ✧ 𝗢𝗩𝗘𝗥𝗩𝗜𝗘𝗪 ✧ This is a roleplay server for Hazbin Hotel and Helluva Boss, built by fans for fans. 𝙒𝙚’𝙧𝙚 𝙖 𝙛𝙖𝙣𝙤𝙣 𝙡𝙤𝙧𝙚-𝙘𝙚𝙣𝙩𝙧𝙞𝙘 𝙘𝙤𝙢𝙢𝙪𝙣𝙞𝙩𝙮, and we take pride in weaving complex stories and character arcs together. Everyone is welcome here—no matter who you are. Our mod team is committed to keeping things safe, inclusive, and drama-free. You can claim up to 2 canon characters and submit as many OCs as your hellish (or heavenly) heart desires. Many major roles are still open, be sure to come in and grab them quick~! We’d love to have you join our circle—come be part of the story. ♡

Today's activity
1💬
26🟢
1👥
0📞
Server overview
55👥Total members
2📅years old
18+Age requirement
server profile pic
Inglorious Sovereignty
animegamescommunitysocialroleplay
user profile pic
thenuclearwarhead08-04-2024 03:47

Alot of cool emojis from jjk, csm, devil may cry, final fantasy and guilty gear

Description

A wonderous server full of people with multiple interests like gaming, anime, music, movies, sharing your hobbies and etc. this server has no rules because what you say shouldn't effect anyone. it should be no different from any conversations you have in real life. I pride myself in the fact this is indeed a multifandom server, i personally like media like pokemon and other games, aswell as movies like The crow or The punisher.

Today's activity
1💬
19🟢
1👥
0📞
Server overview
51👥Total members
1📅years old
13+Age requirement
server profile pic
The Underverse
lgbtq+lgbtqialgbtqia+ roleplayroleplayunderfellundertaleunderverse
user profile pic
fell_sans_simp29-12-2023 22:24

Join for Undertale friends!!

Description

LOOKING FOR MODS!! 15+ ONLY SERVER! Please don't join if you're under 15. Hello! This is a new server that I created for all of the “weird kids” that never grew out of their Undertale phase. It's NOT just a roleplay server but there are roleplay channels for those interested! I worked really hard on it, so I'd really appreciate anyone who'd like to join and come hang out :3

Today's activity
1💬
21🟢
1👥
0📞
Server overview
93👥Total members
1📅years old
15+Age requirement
Description

After a fight broke up Elizabert Megafig's expedition team, and caused her to go missing, a journalist arrived on Snaktooth Island. They've been a huge help in uniting everyone, well almost. Eggabell Batternugget can't come back until they unlock this mysterious stone door. Behind it she believes lies Elizabert, and she can't go back without her. Its taking her quite a while however, and while the others have been waiting, it appears Snaktooth has been able to get more Grumpuses into its grasps, with many travelling or ending up shipwrecked there, and new Bugsnax have begun to appear as well! Things on Snaktooth are about to get very, very, interesting. Can you brave the Trials of Snaktooth and uncover its mysteries?

Today's activity
1💬
19🟢
1👥
0📞
Server overview
40👥Total members
2📅years old
13+Age requirement
server profile pic
[||Soleida Harbor||]
roleplaywritingOCslice-of-lifefantasy
Description

[Soleida Harbor is a fishing town. The atmosphere is much like a town or even a small city with many residents and shops. There is more information of the town's lore within the server itself, of course. There are many roles (Color, pronoun, etc.), and even more channels! Please bring forth your creative minds and come check the place out.]

Today's activity
0💬
6🟢
0👥
0📞
Server overview
15👥Total members
6📅months old
17+Age requirement
Description

This SFW server is dedicated to adults [18+] roleplaying in a Cyberpunk Universe where anything can happen. Thanks to the Blackwall Incident and the opening of rifts across Night City, characters from countless worlds and timelines have been dragged into this dystopian chaos. Whether you're a warrior from a fantasy realm, a superhero from a modern city, or a survivor from a post-apocalyptic wasteland, Night City will challenge everything you know. Cybernetic enhancements have replaced tech, magic, and powers here—but that doesn’t mean people are powerless. The city is filled with corruption, power struggles, and rebellion. Survival isn’t just about making it through the day—it’s about carving out your legacy. So bring your favorite characters, reimagine them in this gritty neon world, and get ready to embrace the edge of your creativity. No Cyberpunk experience? No problem. If you love Sci-Fi, writing, and exploring new takes on your favorite characters, this server is for you! We’re a canon character literate-novella style roleplay that encourages creativity and collaboration. Whether you’re here to write, hang out, or experience the chaos of Night City, you’ll find your place here.

Today's activity
0💬
15🟢
0👥
0📞
Server overview
18👥Total members
2📅years old
18+Age requirement
server profile pic
Cape Comm
minecraftminecraft-serverminecraft-smpsmpminecraft-communityminecraft-survivalsurvival-multiplayermcmc-serverminecraft-playersminecraft-javaminecraft-bedrockgaminggaming-communityfriendly-communityactive-communitychillhangouteventscommunitygiveawaysmodded-minecraftvanilla-smplifesteal-smproleplayeconomycustom-pluginswhitelistednon-toxic18+13+minecraft-ogog-usernamesog-names3-letter-names4-letter-namessemi-ogname-snipingname-tradingminecraft-capesfree-capescustom-capescape-tradingminecraft-cosmeticsskin-customizationcosmetic-tradingusername-marketplaceminecraft-collectiblesminecraft-vanityminecraft-identityminecraft-usernameminecraft-username-tradingminecraft-username-collectingminecraft-skinsminecraft-vanity-itemsminecraft-username-marketplaceminecraft-username-collectorsminecraft-cape-collectors
Description

Cape Comm is a Minecraft server that is all about the Minecraft OG & caped community. That includes everything about capes and leaks about new upcoming capes. We also talk about OG Minecraft usernames and much more. We also do lots of giveaways, including MCE cape codes alongside other things!

Today's activity
0💬
9🟢
0👥
0📞
Server overview
2.0k👥Total members
5📅months old
13+Age requirement

213 servers found