Rp Discord servers

210 servers found

Description

𝐒𝐄𝐕𝐄𝐍.. 𝐒𝐈𝐗... 𝐄𝐋𝐄𝐕𝐄𝐍... 𝐅𝐈𝐕𝐄... 𝐍𝐈𝐍𝐄 𝐀𝐍' 𝐓𝐖𝐄𝐍𝐓𝐘 𝐌𝐈𝐋𝐄 𝐓𝐎-𝐃𝐀𝐘... 𝐅𝐎𝐔𝐑... 𝐄𝐋𝐄𝐕𝐄𝐍.. 𝐒𝐄𝐕𝐄𝐍𝐓𝐄𝐄𝐍.. 𝐓𝐇𝐈𝐑𝐓𝐘-𝐓𝐖𝐎 𝐓𝐇𝐄 𝐃𝐀𝐘 𝐁𝐄𝐅𝐎𝐑𝐄..

⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆
est. 7th November 2023. The most long lasting, active vibey aot rp server you'll ever find. **SERVER TAG + EXCLUSIVE ROLES!!** ( and 24/7 poketwo)

Interested in joining a chill out aot rp server on disc thats also active, with amazing and hilarious (and actual NON toxic) members? This server supports all styles of RPing. Here's why you should join:
╰┈➤There are SO many available canon characters to choose from, (and by choosing a canon, you're also guaranteed a unique role, [yes- even the "minor side characters"] no service required!) and we LOVE OCs!! There are many activities that take place including royal balls/galas, battles, path sequences and so much more.. and even an actor au! ╰┈➤The server allows you to focus on your character as well as their interactions with others. NO ONE is ever left out in the plot.
╰┈➤Choose where your character comes from (if an OC) I.E Marleyan or Eldian. There are loads and loads of different channels, (including Marley, beyond the walls, and more!) This server also doesn't have an over-the-top combat system or rules, you can go crazy! (just not OP.)
╰┈➤The plot has a perfect balance of comedy, combat, romance, serious RP and many tear jerking moments.
╰┈➤ This server is perfect for any RPer who is just starting out, getting back into the fandom, or just wants a chance to show off some writing. But wait, there's more!
╰┈➤ We don't just do RP here. We have regular silly VC's, music nights, game streams, UNO, and many more! With that said, thank you so much and I know we'll all be able to give eachother a memorable RP experience!
⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆

𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒... 𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒.. 𝐌𝐎𝐕𝐈𝐍' 𝐔𝐏 𝐀𝐍' 𝐃𝐎𝐖𝐍 𝐀𝐆𝐀𝐈𝐍.. 𝐓𝐇𝐄𝐑𝐄'𝐒 𝐍𝐎 𝐃𝐈𝐒𝐂𝐇𝐀𝐑𝐆𝐄 𝐈𝐍 𝐓𝐇𝐄 𝗪𝐀𝐑.

Today's activity
1.6k💬
106🟢
45👥
0📞
Server overview
462👥Total members
2📅years old
13+Age requirement
server profile pic
city in the sky · fluffy tag
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
4.6k💬
384🟢
94👥
0📞
Server overview
2.8k👥Total members
1📅years old
13+Age requirement
server profile pic
Oaths of Steel
roleplayroleplayinghouse of the dragongame of thrones
Description

🏰 Oaths of Steel | House of the Dragon RP 🐉

Enter the world of Westeros, where loyalties can shift like the wind and the bold carve their names into history.

🔥 Year 115 AC. The realm flourishes under the rule of Queen Vaelana Targaryen, First of Her Name. With dragons soaring above Westeros and noble houses vying for influence, the Iron Throne sits ever vulnerable to ambition, treachery, and blood.

Oaths of Steel is an immersive, literate roleplaying server set in the brutal and beautiful world of Game of Thrones / A Song of Ice and Fire (Set in the era of House of the Dragon). Whether you're a scheming noble in King’s Landing, a Night’s Watch ranger at the Wall, or a Knight claiming glory in battle — your story begins here.

🌐 What We Offer:

📜 Original Characters

🗺️ Detailed maps, custom lore channels, and deep worldbuilding.

⚔️ Political Intrigue & War

🐉 Player-driven plots with mod-run events and consequences.

🐺 All Houses Open (except Targaryen (for now!))

🕊️ LGBTQ+ friendly, 17+ community

🎭 Come if you love:

Deep character arcs

Strategic alliances & betrayal

Lore-rich fantasy settings

Join us. Swear your oath. Shape the realm.

"The game is yours to play — and the price is yours to pay."

Today's activity
4.5k💬
20🟢
22👥
0📞
Server overview
38👥Total members
3📅years old
17+Age requirement
server profile pic
𝗗𝟰
communitysocialchillroleplaygaminggameshangoutanimefriendsfunfriendlyartchatmusicvcactiverobloxminecraftsfwlgbtq+memesrpmangaeventspoliticsvaloranthorrorenglishnon-toxicprogrammingaianime rpegirlsreading13+lgbtqcatsteenbookslgbtq friendlyactive-communityfootballvoice chatsportstechnologycutegamersnontoxicbookclubgtaegirlteensmusic producersgoofymusicianweedartsadultsemojiapexvoice-chattechnicalraidsgamergame nightsfun factshang outvaporwavegame-devlgbtq+ friendlyactive voice chatno toxicitygta vdeveloperspersonal developmentmusic botsemotomb-raiderclassical musiceboystechsoccerstorysocial community vc fun friendlylgbt friendlysmokingteen-friendlyactive-voicechat420house of the dragonanime rpgvcsemojisraidingskateboardinggamer-girlsweebnukevapingeboyd4gamer-girlskatingscooterraiderssk8stonervaporprogrammersskatergamergirl
Description

𝗗𝟰 𝗶𝘀 𝘁𝗮𝗶𝗹𝗼𝗿𝗲𝗱 𝘁𝗼 𝗮𝗹𝗹 𝗽𝗲𝗼𝗽𝗹𝗲 𝘄𝗵𝗼 𝗷𝗼𝗶𝗻.
● sғᴡ → ᴀʀᴛ
● ᴛᴇᴄʜ → ᴀɴɪᴍᴇ
● ᴍᴜsɪᴄ → ᴍᴇᴍᴇs
● ᴇᴠᴇɴᴛs → sᴏᴄɪᴀʟ
● ᴀᴄᴛɪᴠᴇ → ᴠᴀᴘᴇʀs
● ᴇ-ʙᴏʏs → ʜɪᴘᴘɪᴇs
● ɢᴀᴍɪɴɢ → ᴇ-ɢɪʀʟs
● sᴋᴀᴛᴇʀs → sᴛᴏɴᴇʀs
● ᴇǫᴜᴀʟɪᴛʏ → ᴀᴛʜʟᴇᴛᴇs
● ᴍᴜsɪᴄɪᴀɴs → sᴛʀᴇᴀᴍɪɴɢ
● ʀᴀᴘ-ʙᴀᴛᴛʟᴇs→ ɴᴏɴ-sᴛᴏɴᴇʀs
● ᴘʀᴏɢʀᴀᴍᴍɪɴɢ → ᴄʏʙᴇʀ-sᴇᴄᴜʀɪᴛʏ
● ᴄᴀᴛᴄʜɪɴɢ-ᴘᴇᴅᴏs → ғʀᴇᴇ-ᴇxᴘʀᴇssɪᴏɴ
● ᴀɴᴛɪ-ᴄᴏʀʀᴜᴘᴛɪᴏɴ → ᴍᴜsɪᴄ-ᴘʀᴏᴅᴜᴄᴇʀs
● ᴄᴏɴᴛᴇɴᴛ -ᴄʀᴇᴀᴛᴏʀs → ᴘᴏᴇᴛʀʏ ᴀɴ ǫᴜᴏᴛᴇs
𝗧𝗵𝗲 𝗽𝗲𝗿𝗳𝗲𝗰𝘁 𝗽𝗹𝗮𝗰𝗲 𝗳𝗼𝗿 𝗺𝗲𝗲𝘁𝗶𝗻𝗴 𝗻𝗲𝘄 𝗽𝗲𝗼𝗽𝗹𝗲 𝗲𝘃𝗲𝗿𝘆𝗱𝗮𝘆.

NON-TOXIC

Today's activity
2.1k💬
153🟢
44👥
26📞
Server overview
684👥Total members
9📅months old
13+Age requirement
server profile pic
DECEIT [RP]
communityroleplayrp
Description

˗ˏˋ ✞ ˎˊ˗ 𝐃𝐄𝐂𝐄𝐈𝐓 ˗ˏˋ ✞ ˎˊ˗ “I will not tell you the visceral details as you already know them, you all do. It's happening to every-body.”
═══════════════
On the eve of the outbreak, Southwood, Alabama's population sat at 8,000. Now? hundreds, a bustling coastal city transformed into nothing more than a shell of it's former glory. It wasn't always this way, yet an inconceivable turn of events left thousands wondering if hope was well and truly lost. You weren't lucky enough to be picked up by the military convoys that left town at the behest of the United States Government, no, you were left behind, discarded, and no matter how unhappy you were about that fact, nothing could change how you were now among Fairhope's last remaining inhabitants. There was no telling just what could happen, the cataclysm of the world as we know it was sure to bring about some major changes. Were you going to embrace it, or desperately cling onto whatever hope humanity had left..?
═══════════════
“No-one you know is a good person.”
═══════════════
What Deceit Offers... {✞}

HORROR + APOCALYPTIC THEMES — Built by a team of previous apocalypse-RPers, Deceit offers a range of apocalyptic themes within it's plotlines, all based in the fictional coastal town of Southwood, Alabama . We don't merely focus on the dark, gritty aspects of the apocalypse, but also the wider picture. We aim to make our world as immersive as possible so that everyone can get the most enjoyment out of roleplaying here.

{✞} CREATIVE SPACE FOR ALL SKILL-LEVELS — With the rise in AI over recent years, we've noticed a severe lack in creative spaces. Deceit offers a creative outlet for writers of all skill-levels, whether you're literate writer who wants to improve their work, or a multi-paragraph writer who wants to tell an immersive story, there's a place for you here. AI is banned entirely.

{✞} INTERACTIVE LORE — We've implemented not only a D20 system, but also certain guidelines for events that mean your choices matter. There are real stakes behind every choice your character makes, meaning every single session carries a unique sort of tension. {✞} MEMBER FEEDBACK — Ultimately, we are not immune to taking criticism. If there are certain aspects of the server that you think could be improved upon, then tell us so we can ensure a positive experience for everyone.
═══════════════

Today's activity
1.2k💬
23🟢
18👥
7📞
Server overview
42👥Total members
2📅years old
13+Age requirement
server profile pic
The Writer's Library {{21+}}
friendlysocialroleplayrpcommunitywritingroleplayerroleplay partnerwritersactive
Description

Welcome to the Writers Library. All writing levels are welcome! We are a 21+ Role Play server. We do request your work be human written. Here you can find yourself lost in the pages of your own creations and meet other writers to join you.

Today's activity
4.2k💬
79🟢
77👥
17📞
Server overview
336👥Total members
5📅months old
21+Age requirement
server profile pic
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥
dungeons and dragonsd&dttrpghobbiesdndtabletoproleplay
Description

The City of Brass is a place for people to share and discuss their hobbies, favorite media, and worldbuilding projects; whether it be for a tabletop game like Dungeons and Dragons, or just for the fun of it! We also like to make and give/receive feedback on Hombrew content for D&D!

Today's activity
100💬
29🟢
7👥
0📞
Server overview
83👥Total members
4📅years old
18+Age requirement
server profile pic
RP n’ Chill
role-playroleplay
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
448💬
123🟢
34👥
0📞
Server overview
1.1k👥Total members
5📅years old
15+Age requirement
server profile pic
/saucee | ask2dm • egirls • dating • social • active
socialcommunitychillroleplaygamesanimefriendsactivemoviesdatingegirledatingfreakyactive-voicechat
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
1.5k💬
129🟢
146👥
6📞
Server overview
2.1k👥Total members
1📅years old
18+Age requirement
Description

+ ━━━━☆ WELCOME TO THE GREENFIELD ACADEMY! ☆━━━━ +

Embark on a thrilling journey into the extraordinary at Greenfield Academy, where the year is 2044, and a new generation of heroes is rising. Dive into a captivating server where you have the power to shape your own original characters and unfold epic tales of heroism and discovery!

✨ Unleash Your Superhuman Potential ✨

Step into the bustling metropolis of Charter City, home to Greenfield Academy, a prestigious institution for molding future heroes. The students possess unique powers inherited from their grandparents who experienced an event known as "The Black Hole Incident." Explore a world where extraordinary abilities are the norm, and the line between hero and villain blurs.

🦸 Craft Your Heroic Legacy 🦸

Create your very own OC, from their compelling backstory to the depths of their superhuman abilities. Immerse yourself in a universe that celebrates originality, where your character's journey is untethered from existing storylines. Join forces with other members to weave tales of heroism, friendship, and self-discovery.

🚀 Soar Above the Rest 🚀

Here at Greenfield Academy, originality reigns supreme. Engage in a rich lore, explore diverse channels to enhance your OC's story, and immerse yourself in a non-toxic community that values creativity and collaboration. We understand the importance of real life, so join roleplays at your own pace without pressure.

What We Offer

- A unique roleplaying experience within the Greenfield Academy universe.
- Diverse channels for character development (Designs, Theme songs, Headcanons, Etc.).
- A welcoming and non-toxic community.
- Flexibility in roleplay participation, attend when you can.

Join us at Greenfield Academy, where destinies are forged, and the legacy of the next generation of heroes begins. Uncover your superhuman potential and let the adventure unfold!

Join the Journey Today!

Today's activity
31💬
25🟢
3👥
0📞
Server overview
93👥Total members
3📅years old
13+Age requirement
server profile pic
Avalon Community | Dedicated Servers & Real Players
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
31💬
119🟢
8👥
0📞
Server overview
1.0k👥Total members
8📅years old
13+Age requirement
server profile pic
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
540💬
42🟢
29👥
5📞
Server overview
138👥Total members
2📅years old
14+Age requirement
server profile pic
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
1.1k💬
570🟢
82👥
35📞
Server overview
6.0k👥Total members
5📅years old
13+Age requirement
server profile pic
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
959💬
2.1k🟢
44👥
7📞
Server overview
12.3k👥Total members
9📅years old
13+Age requirement
server profile pic
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
657💬
58🟢
15👥
0📞
Server overview
199👥Total members
3📅years old
13+Age requirement
server profile pic
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
1.6k💬
78🟢
36👥
21📞
Server overview
1.2k👥Total members
3📅years old
13+Age requirement
server profile pic
Rus' | Into The Frost
adventurefantasymedievalroleplay
Description

With a long winter preparing to encapsulate the Tsardom of Rus' and all living things within the Russkaya Zemlya, we invite you to join us in the new and improved Rus' Universe. Dobro pozhalovat' v Rus! Welcome to the Rus', my friend. The "Rus' | Into The Frost" is a server based on 15th-Century Medieval Russia with a fantasy twist. Imagine a world where legendary creatures found in traditional folklore coexisted alongside ManKind. It is in our universe that adventurers from all corners of the globe travel to the Land of the Rus' to test their mettle against the ferocious beasts that dominate the cold lands. Limited by only your own brilliant creativity, you are allowed to start off as a majestic and nimble Kitsune from the Far East—using magic to turn your foes to dust. You can even try to slay beasts as an Elven Archer from the Germanic Region who can strike down their prey from miles away, a werewolf, vampire, orc, and so much more. Don't be afraid to strive for whatever your artistic mind desires. This is a community that accepts all passionate to write, role-play, and help build an immersive universe influenced by its members and everything we do as a community. Upon joining, we ask that you take the time to read the instructions provided in our welcome channel. We are a very well-written and fleshed-out server. We hope that you'll be joining us very soon on our courageous adventures, friend.

Today's activity
357💬
13🟢
8👥
0📞
Server overview
41👥Total members
3📅years old
18+Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
6.0k💬
148🟢
45👥
0📞
Server overview
697👥Total members
6📅years old
14+Age requirement
server profile pic
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
47💬
27🟢
10👥
0📞
Server overview
153👥Total members
4📅years old
15+Age requirement
Description

"You'll face death, and it won't be pretty.
Enough death to leave your broken, time and time again...."

Congratulations! The application you submitted to become a part of Project Epsilon has been accepted! Welcome aboard!

Hello and a warm welcome to Halo: Project Epsilon! This is a server where you take the role as an agent of Epsilon. You will embark on a whole variety of missions to various ancient and fantastical planets (created by yours truly) to combat the rising power of the evil Red Talon corporation. While working alone in this server is plausible, it is also foolish. We here at Epsilon are huge advocates for teamwork as it not only improves overall RP experience, but it also leads to more interesting and diverse scenarios for you and your new friends to enjoy. You heard me right, friends! Epsilon gladly welcomes anyone of any race, culture, background or identity, regardless of whether or not you are a member of the LGBTQ+ or if you are just an 8ft tall Sangheili, we are all friends here!

This is based on Red VS Blue’s project freelancer and is a custom rp server that involves:
- Team based mission RP 🕴️
- A competitive leaderboard to flex on all your pals 💪
- Frequent and inclusive events (nitro) 🫨
- Friendly staff who will be your new best friends 😎
- Acceptance of everyone, unless you are from Formby, which case I want my money back 🏳️‍🌈
- POKECORD 🦆
- Comedy 🤓
- Women (I think)🤷
- HUNGER GAMES! 🕺
- CQ Cumber 🐐
So if you like what I described and you think this server fits your vibe. Join! I would love to see you there and so would everyone else. If you still have any questions then all you got to do is ask me or our dedicated staff team (I love them) who will gladly offer assistance to solve any quibbles and quabbles you may have. I truly hope to see you there.

-Colorado

Today's activity
94💬
27🟢
5👥
0📞
Server overview
133👥Total members
6📅years old
13+Age requirement
server profile pic
Divinity's Rapture
communityroleplayroleplayingchillsocialanimelgbtq+fireemblemfe3h18+anime rp
Description

(SFW RP, but hidden ooc nsfw channel)

(Past and "modern" versions of characters are, essentially, separate people, and exist at the same time.)

The year is 1885, nearly 700 years after the War of Unification for Fódlan. Peace and prosperity reigned across the land as students far and wide made their way to the esteemed officers academy. A professor awaits for a new opportunity to teach as three important heirs make their way to Garreg Mach alongside their comrades. Little did any of them know however the peace they knew would come crashing down. Those from the past arrived both friend and foe. While the newly lost Fell Star seeks to restore balance and preserve this world the King of Liberation and his allies move to conquer and destroy. For the past was never meant to encounter the future and the dead should have been left to rest. Memories blur as the inhabitants of Garreg Mach attempt to understand who they are and what this all entails.

(Welcome to Divinity’s Rapture! An FE3H time travel au featuring the messy attempts at finding a perfect ending and the consequences that follow. Follow the story as the past is flung into an alternate far future all while reality desperately attempts to piece itself together. )

Today's activity
66💬
20🟢
8👥
0📞
Server overview
37👥Total members
10📅months old
18+Age requirement
server profile pic
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
1.5k💬
73🟢
53👥
3📞
Server overview
406👥Total members
3📅years old
16+Age requirement
server profile pic
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
20💬
30🟢
4👥
0📞
Server overview
133👥Total members
1📅years old
16+Age requirement
server profile pic
Fluid Client
communitysocialactivechillroleplaygaminghangoutgamescreativefriendsfunfriendlyartchatmusicvcsfwrobloxminecraft
Description

Ready to take your Minecraft adventures to the next level? Fluid Client, the unrivaled Minecraft client for 1.8.9, is your ticket to endless possibilities! 🌍 Unleash your imagination, conquer challenges, and build your way to victory! Download now at https://fluidclient.ovh/download.

Today's activity
30💬
587🟢
19👥
1📞
Server overview
10.3k👥Total members
2📅years old
13+Age requirement
server profile pic
It's Your Power!
roleplayrpmhamy hero academiamha-rproleplayingmy hero academia-roleplay)my hero academia-rppartnership
Description

🌟 IT’S YOUR POWER! — MY HERO ACADEMIA RP 🌟

🦸‍♂️ Do you have a hero OC?
🦹 A villain with a cause?
👤 Or a civilian just trying to survive in a superpowered world?

It’s Your Power! is a My Hero Academia–based roleplay server set in a post-war, hybrid timeline, where hero society is rebuilding—and redefining itself.

In this world, most humans possess Quirks, superhuman abilities that shape daily life, careers, and conflict. Hero schools still stand, villains still lurk, and the line between right and wrong has never been thinner.

What sets us apart?

✨ Play who you want.
You’re not limited to hero students. Play:
Hero students, Pro Heroes, Villains, Vigilantes, Civilians, Support and business roles
…and more.

🏫 Multiple Hero Schools

U.A. High School

Shiketsu High School

Deika City University (DCU) — a bold, experience-first hero institution

📖 Story-Driven World
The world reflects the consequences of canon events, while leaving room for player-driven stories, growth, and server-wide arcs.

🌈 Inclusive & Community-Focused
Whether you’re here for intense plots, character development, or casual RP, there’s a place for you.

🔹 What We Offer:

• Friendly and welcoming community
• Clear rules and active staff
• Self-assignable roles
• Open RP channels (no forum locking)
• RP events and story arcs
• LGBTQ+ friendly environment
• Unlimited original characters
• Canon characters available to claim
• Partnerships welcome

Step into a world where power doesn’t define destiny.

It’s not about the Quirk you’re born with.
It’s about what you choose to do with it.

💥 It’s Your Power! 💥

Today's activity
1.2k💬
39🟢
37👥
1📞
Server overview
108👥Total members
2📅months old
15+Age requirement
Description

ꕤ˖⸝⸝₊˚ Heiwa: 𝐆𝐨𝐥𝐝𝐞𝐧 𝐅𝐚𝐭𝐞 — a Medieval Fantasy Roleplay Server Long ago, the Epoch Shift shattered history; revealing a hidden orange-glowing moon, Nimiel, and changing the world as we know it. Civilizations now rise from the ruins, rediscovering old gods, lost kingdoms, and mysterious crystals embedded deep within the land. Ecosystems evolving far faster than we can keep up with, people redefining themselves and their lives. In this world, magic is a muscle, not an infinite force. Each spell strains the body. Power comes from training, endurance, and discipline. Your story begins here - when anything and everything you do can change the course of the story, how will you choose to live? 𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃 Heiwa is currently in a TRIAL PHASE. From now until NEW YEARS, the server is open for character-making and roleplaying, but no important lore events will occur. If you want to get in to make a mark before we truly kick off, now is the time! Deep, original lore (two moons, a shattered epoch, divine politics, unique magic system) Friendly, active community OC-focused, literate & semi-literate roleplay Medieval fantasy aesthetic Multiple regions, factions, and cultural paths Helpful staff, open channels for new players Event-driven storytelling + player-driven plots Safe, welcoming environment for all Ready to step into the new era? Join the world shaped by Mōna and awakened by Nimiel. Your story awaits.

Today's activity
26💬
52🟢
9👥
1📞
Server overview
110👥Total members
3📅months old
13+Age requirement
server profile pic
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
1.7k💬
73🟢
22👥
0📞
Server overview
232👥Total members
2📅years old
13+Age requirement
Description

A pretty chill Kirby Roleplay server. Just follow the rules and you’ll have fun. We’re currently a small server and we hope to see you join

Today's activity
17💬
40🟢
3👥
0📞
Server overview
114👥Total members
10📅months old
13+Age requirement
Description

a good roleplay server with a gossip girl based lore!

Today's activity
10💬
48🟢
4👥
0📞
Server overview
312👥Total members
2📅years old
13+Age requirement
server profile pic
the Eternity
horrorroleplaywriting
Description

a new, somewhat horror based rp server set in a luxury hotel. Ocs and canon characters are allowed. We're just starting off, so join now!

Today's activity
9💬
9🟢
3👥
0📞
Server overview
17👥Total members
2📅years old
16+Age requirement
server profile pic
Marvel: Twisted Mirror {RP}
marvelmarvel roleplaymarvel rproleplay
Description

In a world that is a patchwork of others, people from other universes are constantly appearing. But there’s a twist: most people drawn to this world are changed from their regular selves.

-Canon characters, OCs, and *altered* canon characters are all welcome
-Variety of RP styles allowed
-Open to suggestions for improving the server and the roleplay

Today's activity
156💬
9🟢
2👥
0📞
Server overview
31👥Total members
2📅years old
13+Age requirement
server profile pic
Dirac Sea
falling frontierroleplayspacethe expansethe sojourn
user profile pic
theonlychen29-08-2023 23:02

We are now cooking with Fusion Fuel

user profile pic
slava_rossii129-08-2023 23:05

This is Captain Lennox Kamal of the Martian Federal Navy, stop right there Rim Periphery Union scum!

user profile pic
aurai_the_trickster30-08-2023 01:51

Want to fire trash cannons and oversized flares at your enemies? Then the Snatchers have you covered!

user profile pic
slava_rossii130-08-2023 02:46

Can confirm, we have Amazon same day delivery services, and the package is a surprise until you join.

user profile pic
slava_rossii129-09-2023 06:12

Okay, ignore my review above, about time for a serious review. To put it simply this server is basically a spin off of The Expanse by James S.A. Corey. Some factions are basically rebranded versions of their factions in the books, such as IPA-UN, MF-MCR, BPU-OPA. On top of that there are unique factions with their own doctrine and technology to name them all, the Rim Periphery Union, and Kuiper Security Pact. Each has their own advantages and disadvantages, the players here do not need to worry about bullshit like shields that cancel out whatever you thrown at it and devolving into an endless argument about who has better technology. Only thing going on is your tactics, maneuvers and exploiting your own advantages and your enemies disadvantages

user profile pic
zolar15902-10-2023 07:29

l

Description

Dirac sea is a spacefaring roleplay and community inspired by the likes of The Expanse, Falling Frontier, and Nebulos fleet command. It is now the 25th century, and humanity has now long since left the confines of its home planet and have colonized vast swathes of the solar system. The invention of the epstien and wormhole jump drives has allowed travel times that would previously take years be done in a matter of weeks or even days, even as far as to help humanity verify the existence of planet 9, later colonized and named as Pales. However, as is typical with humanity and the conflicts they sow, summarized in the words of a asteroid belt miner: “Humanity had a garden that was filled with riches of water, air, and a blue sky. And yet, they not only almost destroyed that garden, they looked past the sky into the stars and beyond. And the first thought that came to their mind was not that of wonder or reverence, but one word: ‘Mine.’”

Today's activity
45💬
19🟢
1👥
0📞
Server overview
60👥Total members
2📅years old
13+Age requirement
server profile pic
Dragon Ball: Clash of Centuries
animeanime rpdragon balldragon ball roleplaydragon ball rpdragon ball superdragon ball zmangamanga rproleplay
Description

In a reality far different from the one you know, a great conflict takes place somewhere in the universe every 100 years... Last time, it was with the Saiyan-Tuffle war, in which the Saiyans had landed on Planet Plant looking for a new home, only for both sides having aggressors and beginning a war. Only after 25 years would the war end, and the two species would share their land... Now, the year before the next great conflict, many elders and those with forseeing eyes have predicted the next location... Earth. Hello, and welcome to Clash of Centuries! We're an OC server with original lore and an original story, only mirroring the canon(s) of Dragon Ball on occasion. We have plenty of variety in races/species to pick from (Earthlings, Saiyans, Cerealians, Demons, etc.), and try our best to keep things balanced. If you want to take part in this unique line of events, then come right on in! Everybody's welcome.

Today's activity
19💬
7🟢
2👥
0📞
Server overview
20👥Total members
1📅years old
13+Age requirement
server profile pic
Test Subjects Official Roleplay
sciencehumansroleplayrealtestinglab
Description

✨ Welcome to Test Subjects ✨

⚙️ The Facility:
A secret lab where science pushes boundaries.

🔬 Roles:

Test Subject: Endure experiments, gain powers or mutations.

Scientist: Conduct experiments, manipulate subjects, chase breakthroughs.


🧬 What Awaits:

Powers, mutations, or failures.

Dangerous tests.

Power struggles, escape attempts, and secret agendas.


🧪 The Question:
Will you thrive, rebel, or control the chaos?

Step into the lab... the experiment begins now.

✨ Welcome to Test Subjects ✨

⚙️ The Facility:
A secret lab where science pushes boundaries.

🔬 Roles:

Test Subject: Endure experiments, gain powers or mutations.

Scientist: Conduct experiments, manipulate subjects, chase breakthroughs.


🧬 What Awaits:

Powers, mutations, or failures.

Dangerous tests.

Power struggles, escape attempts, and secret agendas.


🧪 The Question:
Will you thrive, rebel, or control the chaos?

Step into the lab... the experiment begins now.

Today's activity
15💬
9🟢
2👥
0📞
Server overview
24👥Total members
1📅years old
13+Age requirement
server profile pic
Taisho High: The First Aces!
fantasyhighschoolmagicocroleplaysci-fi
Description

WELCOME TO THE GRAND REOPENING OF TAISHO HIGH!

Whether you're a visitor looking in, or returning member, we welcome you with open arms! We're an exciting high school based RP server, which takes place further inti the future!

✨Rise through the ranks and discover your true power! ✨

At taisho high, you can expect:

* An easy to understand class system

* Wide range of freedom for OC'S

* Several opportunities for deep character development

* Engaging events, with valuable server rewards

* Helpful staff

* Progression of power

And much more!

Will you become a true Ace?

Today's activity
12💬
30🟢
2👥
0📞
Server overview
64👥Total members
2📅years old
13+Age requirement
Description

*A girl moves house with her mother and discovers that it was her childhood home where her sister went missing. The forest next to the house draws her in and she wakes up there every night at 1am ever since she first explored. She meets a bunch of people from all different points in time who are also stuck in the forest. They have to fight off all kinds of monsters together and have a few laughs on the way before tragedy.*

Today's activity
9💬
21🟢
2👥
0📞
Server overview
116👥Total members
1📅years old
13+Age requirement
Description

Violent winds hissed around the borders of Empyrea. Intimidating avians stood guard with shimmering swords and heavy armour.
Suddenly, a voice rung out.
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
𝐍𝐨𝐧-𝐀𝐯𝐢𝐚𝐧 | "Stand on the wall for your picture." You walk over to the wall, the border patrol agent looking you up and down. A snap flashes before you. "Fill this out." You fill out your date of birth, full name, species, and give it back. After a moment, the following is handed to you and the barrier opens.
╔═══ .·:·.⚔︎✧ ✦ ✧𓂋.·:·. ═══╗
ᴇᴍᴘʏʀᴇᴀ ɪᴅ ᴄᴀʀᴅ
Identification NO: 13XXXX
DOB: M/D/Y
Issue Date: M/D/Y
Full Name: Jane Doe
Species: Species
Class: A0 - A4
Sect: -
ꜰᴏᴜɴᴅ? ʀᴇᴘᴏʀᴛ ᴛᴏ ᴇᴍᴘʏʀᴇᴀɴ ʙᴘ ᴏꜰꜰɪᴄᴇ.
╚═══ .·:·.⚔︎✧ ✦ ✧𓂋.·:·. ═══╝
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
𝐀𝐯𝐢𝐚𝐧 | "Identification card please." You hand over your ID card. The Border Patrol Agent glances at it, you, and nods. "Welcome back." The barrier opens.
╔═══ *.·:·.⚔︎✧ ✦ ✧𓂋.·:·.* ═══╗
ᴇᴍᴘʏʀᴇᴀ ɪᴅ ᴄᴀʀᴅ
Identification NO: 01XXXX | 02XXXX
DOB: M/D/Y
Issue Date: M/D/Y
Full Name: Jane Doe
Species: Avian
Class: A0 - A4 | DO -D4
Sect: Warrior | Noble
ꜰᴏᴜɴᴅ? ʀᴇᴘᴏʀᴛ ᴛᴏ ᴇᴍᴘʏʀᴇᴀɴ ʙᴘ ᴏꜰꜰɪᴄᴇ.
╚═══ *.·:·.⚔︎✧ ✦ ✧𓂋.·:·.* ═══╝
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
ʟɪᴋᴇ ᴡʜᴀᴛ ʏᴏᴜ ʀᴇᴀᴅ? ᴍᴏʀᴇ ɪɴꜰᴏʀᴍᴀᴛɪᴏɴ ᴀᴠᴀɪʟᴀʙʟᴇ ᴀᴛ: https://discord.gg/hw8thdvh9D
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
ꜱᴜᴍᴍᴀʀʏ: ʟᴀɴᴅ ᴏꜰ ᴇᴍᴘʏʀᴇᴀ ɪꜱ ᴀ ꜰʀᴇᴇꜰᴏʀᴍ ꜰᴀɴᴛᴀꜱʏ ꜱᴇʀᴠᴇʀ ʜᴏᴍᴇ ᴛᴏ ᴛʜᴇ ᴇᴍᴘʏʀᴇᴀɴꜱ. ᴡᴀʀʀɪᴏʀꜱ ᴀʀᴇ ᴇᴍᴘʏʀᴇᴀ'ꜱ ᴀʀᴍᴏᴜʀ, ᴅᴇꜰᴇɴᴅɪɴɢ ᴛʜᴇɪʀ ᴍᴏᴛʜᴇʀʟᴀɴᴅ ᴡɪᴛʜ ʙʀᴀᴠᴇʀʏ ᴀɴᴅ ʜᴏɴᴏʀ. ɴᴏʙʟᴇꜱ ᴀʀᴇ ᴇᴍᴘʏʀᴇᴀ'ꜱ ʙʟᴏᴏᴅ, ꜱᴜꜱᴛᴀɪɴɪɴɢ ᴛʜᴇɪʀ ᴄᴜʟᴛᴜʀᴇꜱ ꜱᴜʀᴠɪᴠᴀʟ. ᴅᴇᴠᴇʟᴏᴘ ᴡʜᴏ ʏᴏᴜ ʙᴇᴄᴏᴍᴇ ᴛʜʀᴏᴜɢʜ ʀᴏʟᴇᴘʟᴀʏ, ᴍɪꜱꜱɪᴏɴꜱ, ᴀɴᴅ ᴇᴠᴇɴᴛꜱ. ᴇxᴘʟᴏʀᴇ ʏᴏᴜʀ ᴘᴏᴛᴇɴᴛɪᴀʟ ᴛᴏᴅᴀʏ: ᴀᴠɪᴀɴ ᴏʀ ɴᴏɴ-ᴀᴠɪᴀɴ!

Today's activity
7💬
15🟢
2👥
0📞
Server overview
26👥Total members
2📅months old
17+Age requirement
server profile pic
Animation Destination Role-play
roleplayDisneyDreamWorksilluminationNickelodeon
Description

Hi! I'm looking for mature people or people 18 years of age and older that love animation to join a Discord roleplay. Roleplay in any style you want. You can choose animated characters from Disney, DreamWorks, Illumination, Nickelodeon, and more. Hope to see you there!

Today's activity
3💬
10🟢
1👥
0📞
Server overview
44👥Total members
1📅years old
18+Age requirement
server profile pic
Grim Circus
roleplayfunrpocblyaoicircushorrorromance
Description

A yaoi rolepay server loosely inspired by the Dark Woods Circus song
------
A circus rolls into town, the sound of a train on long abandoned tracks, tents set up at the edge of town. The forms of the performers is strange, a deformed beauty with the voice of an angel, the ringmaster with the glowing eyes and pointed teeth hidden behind a charming smile.
As men start to go missing, the circus vanishes just as suddenly as it was set up, the only evidence it was ever there is popcorn and hay scattered and trodden into the grass
At the next town, new faces can be found among the members of the circus and there is fresh meat on the plate of the freakshow's cannibal. At the end of the show odd features can not be removed.
The charming ringmaster has tricks up his sleeves. A witch twisted by solitude and torture, he collects boys and twists them like he was, changing their appearance to his fancy with surgery and magic, taking apart those who do not meet his standards for parts, disposing of what he can't use in the bellies of beasts. His collection is cursed and bound so they can never abandon the circus.
Once you are lured into the circus you can never leave.
Are you ready to join the circus?
------
Please only join if you are 18 or older, We'd like to fully be able to explore the horror themes that could apply to the setting. It is however sfw in the main areas.

Today's activity
2💬
8🟢
2👥
0📞
Server overview
19👥Total members
5📅months old
18+Age requirement
server profile pic
Dragon Ball Finality
communityroleplayvoicedbzdbdragon ball
Description

🌌 DRAGON BALL FINALITY 🌌
An 18+ literate, stat-based roleplay server

📜 The Setting
Age 430 — the Earth is raw and untamed.
No capsules, no space travel — only scattered kingdoms, hidden dojos, and wandering martial artists. Ki is rare, magic is feared, and demons stalk the shadows. Every punch, every beam, every choice shapes history.

⚔️ Plot System
» A-Plots – Admin-led, canon, world-shaking.
» B-Plots – Player + admin collab, canon, medium scale.
» C-Plots – Player-run, flexible, fun, sometimes canon.

✨ Features
» Unique stat-based combat system (Ki • Effort • Magic).
» Automation bots keep fights fast & fair.
» OC-driven stories – forge your own legend.
» 18+ only, zero-tolerance for harassment.

👊 Will you fight for glory, survival, or something greater?
The World is waiting.

Today's activity
2💬
23🟢
2👥
0📞
Server overview
39👥Total members
7📅months old
18+Age requirement
Description

A Hunger Games roleplay!

Today's activity
1💬
25🟢
1👥
0📞
Server overview
115👥Total members
4📅years old
16+Age requirement
server profile pic
Las Vegas RolePlay
gta vxboxroleplaygta rp
Description

A new GTA V rp server for xbox rises up, come and join, join the community.

Today's activity
1💬
8🟢
1👥
0📞
Server overview
24👥Total members
1📅years old
15+Age requirement
server profile pic
|| JJK || The Jujutsu Experience
jjkjjk roleplayjjk rpjujutsu kaisenjujutsu kaisen roleplayjujutsu kaisen rproleplay
user profile pic
gumeybear2122-09-2024 13:04

a

Description

The Jujutsu Experience! It's a roleplaying/hangout JJK server!! Your oc's make the future! It's simple and an up n' coming server. - Cannon Techniques to be claimed by YOUR ocs ;o - Friendly staff (I think I'm friendly anyways) - Easy to understand templates - Sukuna's vessel up for grabs >:)) So why don't you come on down and join! Even if you just want to hangout and chat, that's what we're here for, but if you want to rp, come make an oc that'll shape the lore of the server!

Today's activity
1💬
76🟢
1👥
0📞
Server overview
297👥Total members
1📅years old
13+Age requirement
server profile pic
Hyperwarp Bewerbung
deutschgermanroleplayrollenspiel
Description

Dem server dem ihr joinen wollt, ist ein Invite only Server und nur für Leute gedacht denen wir vertrauen/die vertrauenswürdig sind. Auf dem Server gibt es keine wirklichen Regeln die einen im rp einschränken, es liegt hauptsächlich bei euch darauf zu achten das alles möglichst Fair bleibt, bei extrem Fällen werden wir als team dennoch eingreifen.

Today's activity
1💬
6🟢
1👥
0📞
Server overview
9👥Total members
1📅years old
14+Age requirement
server profile pic
Warriors Roleplay Hub
roleplaywarrior catswarriors
Description

Warriors Roleplay Hub is a place to find other Warrior Cats role-players easily! We have separate categories for all styles of literacies.

Today's activity
1💬
4🟢
1👥
0📞
Server overview
6👥Total members
1📅years old
16+Age requirement
server profile pic
𝐡𝐞𝐢𝐰𝐚: 𝐠𝐨𝐥𝐝𝐞𝐧 𝐟𝐚𝐭𝐞
actioncrpcustomdramaeconomyfantasyfantasy rpfightliteratemagicocoriginalroleplayromance
Description

⁽⁽ 𝐇𝐄𝐈𝐖𝐀: 𝐆𝐨𝐥𝐝𝐞𝐧 𝐅𝐚𝐭𝐞 ⁾⁾ - 𝐀𝐑𝐂 𝟏: 𝐓𝐡𝐞 𝐒𝐧𝐚𝐤𝐞. The evolution of magic has left Heiwa quickly rising into a global power, with it's citizens being some of the strongest: that also makes it a target. The island has maintained a delicate equilibrium between the monarchy, the magic council, and the general population. With Independence having been around for a little over 150 years, the country has been evolving and adapting at an incredible rate; with this progress came turmoil, and now a serpent has risen from the shadows - the island faces newfound peril, causing an unforeseen test for it's citizens. The previously smooth operation of their society now stands at a crossroad, with uncertainty looming over the future. ◈ 95% custom lore: while set in the real world, it is years in advance and countries have custom lore attached to them. With AT LEAST one major event every month, events are run frequently and can be run by both staff AND regular members alike.

Today's activity
1💬
23🟢
1👥
0📞
Server overview
50👥Total members
2📅years old
13+Age requirement
server profile pic
Homework Helpers
communitysocialroleplaystudy
Description

Interact with fellow students and tutors to enjoy your stay in school! We share tips on how to balance work and attain academic achievement . Welcome to this beautiful experience!!!!

Today's activity
1💬
11🟢
1👥
0📞
Server overview
57👥Total members
2📅years old
18+Age requirement
Description

We are a D&D server based around our custom world, Confractia, if there is a campaign you want, you will find it here, if not, then you can DM one. Currently we have a strong community and hope to have more people. We occasionally play games like Gartic phone, Minecraft, and others. We allow for beginners to join, and for people who have never even heard of D&D; Any skill level is allowed.

Today's activity
1💬
20🟢
1👥
0📞
Server overview
62👥Total members
2📅years old
13+Age requirement
server profile pic
Under Claw - Explore Tarragon
d&droleplaydnddungeons and dragonswestmarchwest marchesdndd&ddungeonsdragonstabletoponeshotone shotlfgttrpgpathfinderp2epathfinder 2e
Description

OICE RP - WEST MARCH - SINGLE GAME MASTER - HIGH QUALITY A custom tabletop system written by me, familiar to 5e but vastly different. You've awoken in the small village of New Flame, with only distant fading memories of your life before. An ashen stone rolled from the Boiling Pools, cracked open to reveal your soundly sleeping form wrapped in ceremonial white cloth trimmed with silver lace. You have become Ashen Born, and you've no way to return to what was before. Your new home is a ruined and ransacked town full of hopeless wretches akin to yourself, having abandoned thought of stepping beyond the towns walls. Many have died attempting to do the same, and after all, it's safe here.  Supposedly, great beasts inhabit the lands beyond. Many choose to venture outside of New Flame in hopes of answers, and a way home. The terrifying roars of those who call the wastes home are followed shortly by screeches of terror, cries of pain, and then silence. The desert sands to the east carry sound surprisingly well. A horrific warning that almost seems by design.  Despite this, you are not content to wither away with the other cowards. Scavenging for supplies in the ruins, eating nothing but birds, lizards, rats, and the occasional wild vegetable as a luxury. You cannot accept that there is no purpose for your arrival, you will not lay down and rot like so many of those who came before you, and you are not willing to die here without a fight.

Today's activity
1💬
17🟢
1👥
0📞
Server overview
29👥Total members
2📅years old
18+Age requirement
server profile pic
KRAKENS REACH - BERMUDAS DEPTHS
socialcommunitychillgaminghangoutwritingeventsrpoccasuallore
Description

The central hub for the beloved Bermudas Depths community, and the house of the Krakenborn. Sip a few beers and praise the Kraken! (This server is application only; the questions are not advanced, they are simply to get you into the right mood for the server.) A developing storyline set in an alternate dimension of the Bermuda Triangle, where demons prey on unsuspecting lost souls... Participate in contests to develop the setting, enjoy reading lore and asking questions about it, play in gamenights, roleplay, or simply exist. We don't mind whichever path you choose.

Today's activity
0💬
14🟢
0👥
0📞
Server overview
21👥Total members
3📅months old
13+Age requirement

210 servers found