Rp Discord servers

210 servers found

server profile pic
/saucee | ask2dm • guild • dating • social • active
socialcommunitychillroleplaygamesanimefriendsactivemoviesegirlfreakyactive-voicechatdatingedating
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
24.9k💬
164🟢
417👥
51📞
Server overview
1.6k👥Total members
1📅years old
13+Age requirement
server profile pic
Pine Creek Summer Camp 🏕
roleplayrpslice of lifesolcommunity
Description

We are an 18+ SFW roleplay server that mainly focuses on slice of life but we encourage our members to be as creative as they wish. Whether you want some adventure, angst, mystery or romance, we can do it all here.

We encourage creativity and enjoy a smattering of chaos from time to time - whether it be kids getting revenge against a mean staff member, escalating prank wars or accidentally burning down the boathouse with a misplaced firework.

The Pine Creek Summer Camp is an inclusive camp for children and teenagers from all walks of life - with special catering for those who are disabled, neurodivergent or in any way impoverished or troubled. With fun indoor and outdoor activities, all are welcome.

We have dozens of indoor and outdoor locations for 1x1 and small group roleplays as well as chatroom style channels you can use to talk as your characters to other characters. We use Tupperbox for added immersion and are happy to help beginners set up their characters and learn how to use it.

What we offer:
▫️ A welcoming, friendly community
▫️ Inclusive to everybody, regardless of race, religion, gender or sexuality
▫️ Dedicated staff who are passionate about roleplaying
▫️ OOC chat channels
▫️ Media, meme, and art channels

Today's activity
398💬
20🟢
12👥
0📞
Server overview
36👥Total members
5📅months old
18+Age requirement
Description

ꕤ˖⸝⸝₊˚ Heiwa: 𝐆𝐨𝐥𝐝𝐞𝐧 𝐅𝐚𝐭𝐞 — a Medieval Fantasy Roleplay Server Long ago, the Epoch Shift shattered history; revealing a hidden orange-glowing moon, Nimiel, and changing the world as we know it. Civilizations now rise from the ruins, rediscovering old gods, lost kingdoms, and mysterious crystals embedded deep within the land. Ecosystems evolving far faster than we can keep up with, people redefining themselves and their lives. In this world, magic is a muscle, not an infinite force. Each spell strains the body. Power comes from training, endurance, and discipline. Your story begins here - when anything and everything you do can change the course of the story, how will you choose to live? 𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃 Heiwa is currently in a TRIAL PHASE. From now until NEW YEARS, the server is open for character-making and roleplaying, but no important lore events will occur. If you want to get in to make a mark before we truly kick off, now is the time! Deep, original lore (two moons, a shattered epoch, divine politics, unique magic system) Friendly, active community OC-focused, literate & semi-literate roleplay Medieval fantasy aesthetic Multiple regions, factions, and cultural paths Helpful staff, open channels for new players Event-driven storytelling + player-driven plots Safe, welcoming environment for all Ready to step into the new era? Join the world shaped by Mōna and awakened by Nimiel. Your story awaits.

Today's activity
1.4k💬
53🟢
26👥
0📞
Server overview
85👥Total members
1📅months old
13+Age requirement
server profile pic
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
97💬
67🟢
13👥
0📞
Server overview
201👥Total members
3📅years old
13+Age requirement
Description

+ ━━━━☆ WELCOME TO THE GREENFIELD ACADEMY! ☆━━━━ +

Embark on a thrilling journey into the extraordinary at Greenfield Academy, where the year is 2044, and a new generation of heroes is rising. Dive into a captivating server where you have the power to shape your own original characters and unfold epic tales of heroism and discovery!

✨ Unleash Your Superhuman Potential ✨

Step into the bustling metropolis of Charter City, home to Greenfield Academy, a prestigious institution for molding future heroes. The students possess unique powers inherited from their grandparents who experienced an event known as "The Black Hole Incident." Explore a world where extraordinary abilities are the norm, and the line between hero and villain blurs.

🦸 Craft Your Heroic Legacy 🦸

Create your very own OC, from their compelling backstory to the depths of their superhuman abilities. Immerse yourself in a universe that celebrates originality, where your character's journey is untethered from existing storylines. Join forces with other members to weave tales of heroism, friendship, and self-discovery.

🚀 Soar Above the Rest 🚀

Here at Greenfield Academy, originality reigns supreme. Engage in a rich lore, explore diverse channels to enhance your OC's story, and immerse yourself in a non-toxic community that values creativity and collaboration. We understand the importance of real life, so join roleplays at your own pace without pressure.

What We Offer

- A unique roleplaying experience within the Greenfield Academy universe.
- Diverse channels for character development (Designs, Theme songs, Headcanons, Etc.).
- A welcoming and non-toxic community.
- Flexibility in roleplay participation, attend when you can.

Join us at Greenfield Academy, where destinies are forged, and the legacy of the next generation of heroes begins. Uncover your superhuman potential and let the adventure unfold!

Join the Journey Today!

Today's activity
18💬
32🟢
6👥
0📞
Server overview
94👥Total members
3📅years old
13+Age requirement
server profile pic
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
4.6k💬
36🟢
26👥
11📞
Server overview
111👥Total members
1📅years old
16+Age requirement
Description

A pretty chill Kirby Roleplay server. Just follow the rules and you’ll have fun. We’re currently a small server and we hope to see you join

Today's activity
37💬
36🟢
3👥
0📞
Server overview
101👥Total members
9📅months old
13+Age requirement
server profile pic
RP n’ Chill
role-playroleplay
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
362💬
147🟢
27👥
0📞
Server overview
1.1k👥Total members
5📅years old
15+Age requirement
server profile pic
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
1.8k💬
55🟢
29👥
11📞
Server overview
1.2k👥Total members
3📅years old
13+Age requirement
server profile pic
KRAKENS REACH - BERMUDAS DEPTHS
socialcommunitychillgaminghangoutwritingeventsrpoccasuallore
Description

The central hub for the beloved Bermudas Depths community, and the house of the Krakenborn. Sip a few beers and praise the Kraken! (This server is application only; the questions are not advanced, they are simply to get you into the right mood for the server.) A developing storyline set in an alternate dimension of the Bermuda Triangle, where demons prey on unsuspecting lost souls... Participate in contests to develop the setting, enjoy reading lore and asking questions about it, play in gamenights, roleplay, or simply exist. We don't mind whichever path you choose.

Today's activity
23💬
13🟢
6👥
2📞
Server overview
22👥Total members
1📅months old
13+Age requirement
server profile pic
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥
dungeons and dragonsd&dttrpghobbiesdndtabletoproleplay
Description

The City of Brass is a place for people to share and discuss their hobbies, favorite media, and worldbuilding projects; whether it be for a tabletop game like Dungeons and Dragons, or just for the fun of it! We also like to make and give/receive feedback on Hombrew content for D&D!

Today's activity
72💬
29🟢
7👥
0📞
Server overview
81👥Total members
4📅years old
18+Age requirement
server profile pic
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
1.4k💬
687🟢
112👥
24📞
Server overview
5.6k👥Total members
5📅years old
13+Age requirement
server profile pic
It's Your Power!
roleplayrpmhamy hero academiamha-rproleplayingmy hero academia-roleplay)my hero academia-rppartnership
Description

🌟 IT’S YOUR POWER! — MY HERO ACADEMIA RP 🌟

🦸‍♂️ Do you have a hero OC?
🦹 A villain with a cause?
👤 Or a civilian just trying to survive in a superpowered world?

It’s Your Power! is a My Hero Academia–based roleplay server set in a post-war, hybrid timeline, where hero society is rebuilding—and redefining itself.

In this world, most humans possess Quirks, superhuman abilities that shape daily life, careers, and conflict. Hero schools still stand, villains still lurk, and the line between right and wrong has never been thinner.

What sets us apart?

✨ Play who you want.
You’re not limited to hero students. Play:
Hero students, Pro Heroes, Villains, Vigilantes, Civilians, Support and business roles
…and more.

🏫 Multiple Hero Schools

U.A. High School

Shiketsu High School

Deika City University (DCU) — a bold, experience-first hero institution

📖 Story-Driven World
The world reflects the consequences of canon events, while leaving room for player-driven stories, growth, and server-wide arcs.

🌈 Inclusive & Community-Focused
Whether you’re here for intense plots, character development, or casual RP, there’s a place for you.

🔹 What We Offer:

• Friendly and welcoming community
• Clear rules and active staff
• Self-assignable roles
• Open RP channels (no forum locking)
• RP events and story arcs
• LGBTQ+ friendly environment
• Unlimited original characters
• Canon characters available to claim
• Partnerships welcome

Step into a world where power doesn’t define destiny.

It’s not about the Quirk you’re born with.
It’s about what you choose to do with it.

💥 It’s Your Power! 💥

Today's activity
880💬
14🟢
21👥
0📞
Server overview
17👥Total members
25📅days old
15+Age requirement
server profile pic
|| JJK || The Jujutsu Experience
jjkjjk roleplayjjk rpjujutsu kaisenjujutsu kaisen roleplayjujutsu kaisen rproleplay
user profile pic
gumeybear2122-09-2024 13:04

a

Description

The Jujutsu Experience! It's a roleplaying/hangout JJK server!! Your oc's make the future! It's simple and an up n' coming server. - Cannon Techniques to be claimed by YOUR ocs ;o - Friendly staff (I think I'm friendly anyways) - Easy to understand templates - Sukuna's vessel up for grabs >:)) So why don't you come on down and join! Even if you just want to hangout and chat, that's what we're here for, but if you want to rp, come make an oc that'll shape the lore of the server!

Today's activity
95💬
106🟢
21👥
0📞
Server overview
329👥Total members
1📅years old
13+Age requirement
server profile pic
Rus' | Into The Frost
adventurefantasymedievalroleplay
Description

With a long winter preparing to encapsulate the Tsardom of Rus' and all living things within the Russkaya Zemlya, we invite you to join us in the new and improved Rus' Universe. Dobro pozhalovat' v Rus! Welcome to the Rus', my friend. The "Rus' | Into The Frost" is a server based on 15th-Century Medieval Russia with a fantasy twist. Imagine a world where legendary creatures found in traditional folklore coexisted alongside ManKind. It is in our universe that adventurers from all corners of the globe travel to the Land of the Rus' to test their mettle against the ferocious beasts that dominate the cold lands. Limited by only your own brilliant creativity, you are allowed to start off as a majestic and nimble Kitsune from the Far East—using magic to turn your foes to dust. You can even try to slay beasts as an Elven Archer from the Germanic Region who can strike down their prey from miles away, a werewolf, vampire, orc, and so much more. Don't be afraid to strive for whatever your artistic mind desires. This is a community that accepts all passionate to write, role-play, and help build an immersive universe influenced by its members and everything we do as a community. Upon joining, we ask that you take the time to read the instructions provided in our welcome channel. We are a very well-written and fleshed-out server. We hope that you'll be joining us very soon on our courageous adventures, friend.

Today's activity
104💬
23🟢
8👥
0📞
Server overview
42👥Total members
3📅years old
18+Age requirement
server profile pic
Dragon Ball Finality
communityroleplayvoicedbzdbdragon ball
Description

🌌 DRAGON BALL FINALITY 🌌
An 18+ literate, stat-based roleplay server

📜 The Setting
Age 430 — the Earth is raw and untamed.
No capsules, no space travel — only scattered kingdoms, hidden dojos, and wandering martial artists. Ki is rare, magic is feared, and demons stalk the shadows. Every punch, every beam, every choice shapes history.

⚔️ Plot System
» A-Plots – Admin-led, canon, world-shaking.
» B-Plots – Player + admin collab, canon, medium scale.
» C-Plots – Player-run, flexible, fun, sometimes canon.

✨ Features
» Unique stat-based combat system (Ki • Effort • Magic).
» Automation bots keep fights fast & fair.
» OC-driven stories – forge your own legend.
» 18+ only, zero-tolerance for harassment.

👊 Will you fight for glory, survival, or something greater?
The World is waiting.

Today's activity
228💬
12🟢
4👥
0📞
Server overview
40👥Total members
6📅months old
18+Age requirement
Description

a good roleplay server with a gossip girl based lore!

Today's activity
320💬
38🟢
16👥
0📞
Server overview
302👥Total members
2📅years old
13+Age requirement
server profile pic
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
240💬
48🟢
13👥
1📞
Server overview
152👥Total members
4📅years old
15+Age requirement
server profile pic
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
674💬
2.4k🟢
38👥
5📞
Server overview
12.3k👥Total members
8📅years old
13+Age requirement
server profile pic
Tales of Ideals
roleplaysuperherosuperheroes
user profile pic
the_sigg02-09-2024 13:23

Testing!

user profile pic
the_sigg02-09-2024 13:24

Hey there, get in!

Description

***For as long as humans have dreamed, we have dreamed of heroes.*** ***What if these dreams could come true? Could the world handle such power?*** ***These are...*** # _ _ _ _ 『 𝕋𝕒𝕝𝕖𝕤 𝕠𝕗 𝕀𝕕𝕖𝕒𝕝𝕤 』 _ _ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ Set in an alternate history version of our world, __**Tales of Ideals**__ tells the story of a world where superheroes have gone all but extinct. Following the destruction of much of civilization, society has lost faith in its protectors. In the United States, those that remain are under the watch of the **Superhuman Public Response** team. Now, in the year 2024, the balance of the world is in the hands of a new age of superheroes. Stagnant for decades, it is finally time for them to rise up again... but will they succeed? Will crime and villainy prevail at last? Or will this age die out before it gets going, and force the world to recover without supers? ### *The future is up to you!* _ _ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ## 𝓕𝓔𝓐𝓣𝓤𝓡𝓘𝓝𝓖: 💥 A world with decades of alternate history to discover! 🌎 Over **60** channels to roleplay in! 👊 The ability to create your own superheroes (or villains!) 🔥 A narrative focused approach, with an evolving world! ⚡ A class- & archetype-based system of character growth!

Today's activity
209💬
23🟢
9👥
0📞
Server overview
46👥Total members
1📅years old
18+Age requirement
server profile pic
Fluid Client
communitysocialactivechillroleplaygaminghangoutgamescreativefriendsfunfriendlyartchatmusicvcsfwrobloxminecraft
Description

Ready to take your Minecraft adventures to the next level? Fluid Client, the unrivaled Minecraft client for 1.8.9, is your ticket to endless possibilities! 🌍 Unleash your imagination, conquer challenges, and build your way to victory! Download now at https://fluidclient.ovh/download.

Today's activity
200💬
513🟢
88👥
1📞
Server overview
9.9k👥Total members
2📅years old
13+Age requirement
server profile pic
city in the sky · fluffy tag
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
13.2k💬
517🟢
112👥
23📞
Server overview
2.8k👥Total members
1📅years old
13+Age requirement
server profile pic
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
3.1k💬
50🟢
23👥
0📞
Server overview
238👥Total members
2📅years old
13+Age requirement
server profile pic
The Writer's Library {{21+}}
friendlysocialroleplayrpcommunitywritingroleplayerroleplay partnerwritersactive
Description

Welcome to the Writers Library. All writing levels are welcome! We are a 21+ Role Play server. We do request your work be human written. Here you can find yourself lost in the pages of your own creations and meet other writers to join you.

Today's activity
5.0k💬
87🟢
68👥
10📞
Server overview
284👥Total members
4📅months old
21+Age requirement
server profile pic
New Beginnings RP
fivemroleplaycustom gangspoliceems
Description

At New Beginning RP, we pride ourselves on upholding top quality roleplay in our US Based Server. Our goal is to provide an immersive, enjoyable roleplay experience for every member of our loving and warm community. NBRP is a Qbox framework built city that provides smooth performance for all whether you’re on a low end or high end PC. Take a venture and explore the possibilities of how you want to achieve your roleplay. Strive as a businessman or become a criminal mastermind by taking over turfs with the ability to spray your identity to build your reputation up. If gang life isn’t for you then you can venture in becoming a mechanic at Auto Exotic, an amazing MLO based in Vinewood with custom uniforms and a work vehicles. However if you prefer something more luxurious then why not visit Moore Stripclub where you can become a doorman, a barman, a dancer or even the man who organises the music to fit the vibe in our epic DJ Booth. Host events such as car meets, stag do’s, birthday parties and much more! We have PD in the city if you’d rather catch those filthy criminals rather than being the criminal escaping the law enforcement. PD has a grappler script allowing you to stop evading criminals on the go to a complete stop. EMS services are also available if you want to save lives. Our city offers a huge range of Lore Friendly Imports as well as PD and EMS vehicles. We have container wars every Friday to Sunday in city for players to compete against each other for epic prizes and its up to you to sell back to the city for $$$ or to keep for yourself. We have drug selling, from Weed to Cocaine to Heroin. If you want to live that civilian life then we have shops available to work at such as Burger Shot and if you want to grind on some side money we have gold panning, go postal, recycle centre, mining, scrap yard and much more. With friendly and helpful staff to a loving and warm community we are here to provide you with the best experience and RP, so we hope you’ll enjoy what our city has to offer.

Today's activity
115💬
19🟢
10👥
4📞
Server overview
42👥Total members
8📅months old
18+Age requirement
server profile pic
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
1.9k💬
43🟢
24👥
5📞
Server overview
127👥Total members
2📅years old
14+Age requirement
Description

*A girl moves house with her mother and discovers that it was her childhood home where her sister went missing. The forest next to the house draws her in and she wakes up there every night at 1am ever since she first explored. She meets a bunch of people from all different points in time who are also stuck in the forest. They have to fight off all kinds of monsters together and have a few laughs on the way before tragedy.*

Today's activity
46💬
22🟢
5👥
0📞
Server overview
120👥Total members
1📅years old
13+Age requirement
server profile pic
Avalon Community Servers
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
43💬
121🟢
12👥
1📞
Server overview
1.0k👥Total members
8📅years old
13+Age requirement
server profile pic
the Eternity
horrorroleplaywriting
Description

a new, somewhat horror based rp server set in a luxury hotel. Ocs and canon characters are allowed. We're just starting off, so join now!

Today's activity
42💬
8🟢
6👥
0📞
Server overview
17👥Total members
2📅years old
16+Age requirement
server profile pic
𝗗𝟰
communitysocialchillroleplaygaminggameshangoutanimefriendsfunfriendlyartchatmusicvcsfwactiveminecraftrobloxmoviesmemesmangafortniteeventsrpcreativevalorantvoicenon-toxicprogrammingdiscordcatssportsfootballservernontoxicanimalsfriendgtaself-promopartnershipsmusiciansmusicianweedmusic producerscontent creatormaking-friendsboyssoccersmokerskategirlsskateboardhang outsmoking420hangoutsfemalecars24/7waxmarijuanafriendly staffskaterswomenskateboardinganti-pedomenpoemshangout-serverfemalesvapingd4partnershipconcentratesamonguscannabisogdankdabthc-concentratessmokeskate-or-diemalevapessk8stonervaporskatersnowboardingdiscord-serverequalitydabsvoicechatvoice chatvoice-chat
Description

A server designed to fit the interests of every member that joins, while being a safe community.

● 𝐀 𝐂𝐎𝐌𝐌𝐔𝐍𝐈𝐓𝐘 𝐌𝐀𝐃𝐄 𝐅𝐎𝐑
┃ WEEBS
┃ GAMERS
┃ STONERS
┃ SKATERS
┃ ARTISTS
┃ HIPPIES
┃ EQUALITY
┃ ATHLETES
┃ MUSICIANS
┃ PROGRAMMERS
┃ MOVIE NIGHTS
┃ CONTENT CREATORS
┃ FREEDOM OF EXPRESSION
● DAILY JOINS MAKING THIS A GREAT SERVER FOR MEETING NEW PEOPLE EVERYDAY

Today's activity
4.6k💬
119🟢
72👥
31📞
Server overview
608👥Total members
8📅months old
13+Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
6.2k💬
145🟢
42👥
4📞
Server overview
676👥Total members
6📅years old
14+Age requirement
server profile pic
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
1.4k💬
94🟢
38👥
0📞
Server overview
383👥Total members
3📅years old
16+Age requirement
server profile pic
Bakugan: Infinite Dimensions
bakuganbakugan battle brawlerspokemonroleplayyugioh
Description

Welcome to the world of Bakugan! This server is the perfect hangout spot for Bakugan fans and collectors all over the world. We have an optional roleplay that welcomes the use of OCs that takes place in an alternate timeline from the legacy anime series. You can expect: A helpful, supportive and inclusive group of people, Active members, Kind moderators who dont abuse power, Space to share your collections and memories, Opportunity to meet new people and make lasting friendships, Several bots to play with, and an optional semi-literate rp experience with a unique story and antagonist, the ability to create your own OCs, cards and bakugan, with fair and balanced game rules with a level up system based on the video game!

Today's activity
14💬
102🟢
7👥
1📞
Server overview
439👥Total members
3📅years old
13+Age requirement
server profile pic
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★
roleplaysocialcommunitychillanimehangoutcreativemangaliterateocbleachbleach rpbleach roleplayanime rpanime roleplaymanga rp
user profile pic
coolin.real15-11-2024 18:14

hi guys!

Description

[**``黒— ★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★``**] ***Join our server for an interesting run, an adventure throughout multiple different worlds and realms, a deeper perspective on several different races and untold stories in this entirely new world. You may fight strong opponents, take on new heights, push yourself beyond your limits and even face off against those above! With or without a purpose, be a an active participant in the lore of our server that revolves entirely on you all. Destroy the strongest hollows or even reapers, quincies, fullbringers, humans (hell anything you name it) this era has ever known or just simply do your own thing; Awaken a bankai, shoot arrows, become an espada or develop a mask! The opportunities are practically endless in this Mugetsu world! With several systems to guide your very actions and several people willing to rp with you where could things go wrong? immerse yourself in our very own Bleach universe, and interact with fellow fans. With engaging roleplay, thrilling storylines, and a welcoming community, this server is the ultimate destination for fans of all ages. Don't miss out on the chance to explore the vast world of Bleach and create unforgettable memories with like-minded enthusiasts. Join now and let’s start up this journey today, Karakura town is awaiting you!*** **Our own unique take on Bleach, you took the time to read this far so we KNOW you’re interested!** **``We offer: A forum based oc submission system where we can easily interact with you and point out certain details Several different templates for multiple different things such as weaponry, zanpakuto, and the different races showcased in the anime/manga! An active staff team The chance to influence the story or have your own arcs Be part of the main cast! Everyone is really, I mean it! A multitude of different systems for important techniques and skills such as the transformations (such as bankai, shikai, training, resurrecion and mastery) A lot of channels that give background information on what you can do with the bleach power systems so even if you haven’t actually seen the series or read the manga you could read up for a basic understanding! The chance to utilise cool transformations, zanpakuto's, kido spells, or even create your own Influence a moving plot a money system a moving story and a chance to give your own two cents``** ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Links: https://discord.gg/uKK8Q3nggG [let's go, your journey starts now!](https://tenor.com/bQ7nQ.gif) Pings: ||@everyone @here||

Today's activity
7💬
116🟢
6👥
0📞
Server overview
518👥Total members
1📅years old
13+Age requirement
Description

[QUICK DISCLAIMER: This is a ROLEPLAY server. If you are here to trade, do not join.] 2 worlds exist, the human world, and the Yo Kai World. They used to be separate, but some time, long ago in the past, their borders got hazy and Yo-Kai started to pour in, and cause all sorts of troubles for humans! Completely invisible to the human eye, they inspirit people and cause problems ranging from the mild annoyance to major danger. Luckily, a device exists to allow humans to see and even befriend the Yo-Kai! Can a peace be reached between the 2 worlds, or is an unseen catastrophe right on the horizon?

Today's activity
20💬
39🟢
2👥
0📞
Server overview
238👥Total members
5📅years old
13+Age requirement
Description

“We were here when you first opened your eyes. And we will still be when you close them.” The Little Things : Endzone, is a continuation of the first Little Things server, a role play server taking place in the wastelands of California after a devastating apocalypse. The world is completely overrun by plant like monstrosities known as NOFs that feed on human beings; they possess intelligent which exceeds human limits by far, and by manipulating the US government, incited a nuclear war that decimated the entire world. Now, in July 3rd, 2120 the world is scarcely populated, and the humans alive are gathered together in settlements across the wastelands as they try to fight for survival.

Today's activity
5💬
12🟢
2👥
0📞
Server overview
26👥Total members
2📅years old
13+Age requirement
server profile pic
Grim Circus
roleplayfunrpocblyaoicircushorrorromance
Description

A yaoi rolepay server loosely inspired by the Dark Woods Circus song
------
A circus rolls into town, the sound of a train on long abandoned tracks, tents set up at the edge of town. The forms of the performers is strange, a deformed beauty with the voice of an angel, the ringmaster with the glowing eyes and pointed teeth hidden behind a charming smile.
As men start to go missing, the circus vanishes just as suddenly as it was set up, the only evidence it was ever there is popcorn and hay scattered and trodden into the grass
At the next town, new faces can be found among the members of the circus and there is fresh meat on the plate of the freakshow's cannibal. At the end of the show odd features can not be removed.
The charming ringmaster has tricks up his sleeves. A witch twisted by solitude and torture, he collects boys and twists them like he was, changing their appearance to his fancy with surgery and magic, taking apart those who do not meet his standards for parts, disposing of what he can't use in the bellies of beasts. His collection is cursed and bound so they can never abandon the circus.
Once you are lured into the circus you can never leave.
Are you ready to join the circus?
------
Please only join if you are 18 or older, We'd like to fully be able to explore the horror themes that could apply to the setting. It is however sfw in the main areas.

Today's activity
3💬
8🟢
3👥
0📞
Server overview
19👥Total members
4📅months old
18+Age requirement
server profile pic
The Democratic Server of Kaeska
political roleplaypoliticschattingroleplay
Description

The Democratic Server of Kaeska is a place where YOU can take charge. Create or join the political parties of your dreams. Run for President. Create laws. Vote on issues. Win the hearts of your fellow servermates. Created and moderated by an experienced team of people, we feature a custom discord bot, and a thriving community. Will Kaeska be the perfect utopia? Or will you run it into the ground? The choice is YOURS. Welcome to the Democratic Server of Kaeska.

Today's activity
3💬
21🟢
2👥
0📞
Server overview
99👥Total members
1📅years old
13+Age requirement
Description

A Hunger Games roleplay!

Today's activity
2💬
22🟢
1👥
0📞
Server overview
121👥Total members
4📅years old
16+Age requirement
server profile pic
Sousen - Fridge
roleplayanimemangarpjjkanime rpanime roleplayjujutsu kaisenjjk rpmanga rpjujutsu kaisen roleplayanime mangajjk roleplayjujutsu kaisen rp
Description

𝐽𝑈𝐽𝑈𝑇𝑆𝑈 𝑆𝑂𝑈𝑆𝐸𝑁 — 𝑅𝐸𝑉𝐸𝐿𝐴𝑇𝐼𝑂𝑁𝑆
⇢ 𝗟𝗢𝗢𝗞𝗜𝗡𝗚 𝗙𝗢𝗥 𝗛𝗘𝗜𝗔𝗡 𝗘𝗥𝗔 𝗝𝗝𝗞 𝗥𝗣?

⇢ Wanna host missions? Wanna make it to the top? And with no stat system, no starting off at the weakest you could possibly be, and both the ability to grow IRP, as well as not having to worry about overbearing restrictions that mess up your character's narrative, while doing so? Well, you're at the right place! Now, on to the actual ad...

⇢ Time comes for us all, no doubt, but death 𝘥𝘰𝘦𝘴 wait.

⇢ The world of jujutsu will never be the same again, not after 𝙩𝙝𝙞𝙨... because 𝙚𝙫𝙚𝙧𝙮𝙩𝙝𝙞𝙣𝙜 is on the brink of changing forever. The turn of the first millenium draws near, and... so much has been lost. The age old war between man and curse has reached its peak, unspeakable evils have been unleashed, and no man, woman or child in Japan has been spared from the consequences. This is the height of the Heian era, what will you do?

Today's activity
2💬
34🟢
2👥
0📞
Server overview
76👥Total members
4📅months old
13+Age requirement
Description

⋆·˚ ༘ * few people in this world are capable of surviving, those of us who are weak will die, and those of us who are strong will fight against the negative emotions of mankind - curses. a twisted reality full of demented creatures, and yet you stand tall amongst us.

live or die, take your pick.

- - - for a tomorrow without tears is a JJK server set in season one of the anime, though we allow characters that show up after that! events are likely to happen, and mods are open for any and all ideas that you may have. we hope to see you there!

? ? ? what do we offer ?

; ; many role-play channels , and are always taking suggestions for more .

; ; plenty of open CC’s waiting to be claimed , and in need of a lot !!!

; ; easy character submissions .

; ; oc and cc’s allowed! up to 4 canon characters and unlimited original characters.

; ; non - toxic server and interactive staff

Today's activity
2💬
11🟢
2👥
0📞
Server overview
21👥Total members
1📅years old
16+Age requirement
Description

***TOKYO GHOUL - TRIBUTES***

*This server is 16+!*
It is modern day Tokyo. Years have passed since the Dragon War. Faux allyships between Ghoul and Mankind have crumbled like castles under poor leadership and glorified silver linings. From the ashes rose tired, angry, and vengeful ghouls that were given fragile promises and hope at living a normal life.

The United Front and newly-instated CCG, lead by Matsuri Washuu, are now at war. The CCG believes that it is their rightful title as Japan's proper justice division and that all ghouls must be executed as a means to prevent a third-wave’s occurrence as well as another Dragon Incident. The wards have been distorted in chaos underneath the surface, as constant warring over Tokyo's wards appears to be never-ending.

The strange world just got stranger. The dead are mysteriously rising, old organizations are returning with new faces and new leadership, and the ghoul and human worlds as we know it are headed for significant changes.

Here there is a very lax ranking system, meaning that, until the free-spots are filled for higher ranking ghouls / investigators you may have to have your character be higher ranked. For those that miss out, do not fret. We are solely-activity based, meaning the longer / more active you are the higher the rank you can become via the Arcane bot level system **in roleplay channels only**. Both canons and original characters are welcome. Create your own paths - your lore is incorporated into the server's lore. Have fun and enjoy your stay!

*What we offer*

- Unlimited OCs
- A complete, unique server with all 24 wards and location channels within them
- Semi-lit - Adv. Lit RP
- A small but growing community of friendly, creative people
- Canon Character roles
- Gartic, music bots and streaming voice chats

Today's activity
2💬
14🟢
2👥
0📞
Server overview
33👥Total members
2📅years old
16+Age requirement
server profile pic
The Oaken City
roleplayfantasymoderncommunityrp
Description

<-| The Oaken City is a fresh community and roleplaying server aiming to provide a wonderful general hang-out place for all those interested! <-|-> Our theme is, in the broadest sense, that of a modern town slice-of-life roleplay. More specifically on a North-European island republic and more interestingly one made into the crossroads of the three existential planes. For the first time in a millennium, humans and fantasy creatures may co-exist again, in the city that has become a symbol of modern prosperity, Eiksby. <-|-> Besides this little bit of lore, our server seeks to accommodate whatever creative interests its members may have as well as provide an enjoyable friendly community for all to enjoy! We wish for friendly chatting, discussion and sharing of ideas to bring all our members together and help us all grow happier and better. <-|-> I hope to have persuaded you, dear reader, and you are always welcome to come join us in The Oaken City! |->

Today's activity
1💬
11🟢
1👥
0📞
Server overview
21👥Total members
11📅months old
16+Age requirement
server profile pic
" Hold On " !! Detroit Become Human RP
dbhdetroit become humanroleplaydbh rpcommunitygamehangoutrp
Description

𖦹ㅤ ̼ ₊ㅤㅤLOADING. . . ㅤ ۪ ֹ

Detroit 2038. Technology has evolved to a point where human-like androids are everywhere. They speak, move and behave like human beings, but they are only machines serving humans. Play three distinct androids and see a world at the brink of chaos – perhaps our future - through their eyes

>﹒Main characters. Funny thing to call people. The world doesn't have main characters. They are just people that suffer and those who cause pain.

A free will. Yes, that's what is causing pain and chaos. There's no "choose" option anymore. There are just people and their will.

Think wisely. Nothing happens without a reason . . .

. . .
. . . . . .

> LOADING FINISHED

> PROCESS TO CONTINUE?
> YES > NO


⊹ ⠀࣪⠀ㅤㅤ ㅤ OUR OFFERT. . . ִ
> many free cc
> helpful crew including admins and mods
> chance to write your own storyline
> oc friendly
> safe community
> semi-lit / literate community
↷﹒⇆﹒

Today's activity
1💬
28🟢
1👥
0📞
Server overview
122👥Total members
1📅years old
13+Age requirement
server profile pic
𝐕𝐞𝐫𝐢𝐝𝐚𝐧 𝐇𝐢𝐥𝐥 𝐀𝐜𝐚𝐝𝐞𝐦𝐲
dark academiahigh school roleplayroleplaysemi-litslice of life
Description

: 𝐂𝐨𝐧𝐠𝐫𝐚𝐭𝐮𝐥𝐚𝐭𝐢𝐨𝐧𝐬! 𝐘𝐨𝐮'𝐯𝐞 𝐛𝐞𝐞𝐧 𝐬𝐞𝐥𝐞𝐜𝐭𝐞𝐝 𝐭𝐨 𝐚𝐭𝐭𝐞𝐧𝐝 𝐕𝐞𝐫𝐢𝐝𝐚𝐧 𝐇𝐢𝐥𝐥 𝐀𝐜𝐚𝐝𝐞𝐦𝐲! ───── ⋆⋅☆⋅⋆ ───── Founded by visionaries Ernest H. Bailey and Norman P. Mizona in Spokane, Washington, Verdian Hill Academy is a prestigious boarding school for the minds of the brightest scholars. Verdian Hill Academy is a present day, semi-lit, dark academia themed high school role play where your OC will study at the best school in America, make the bestest of friends, find lovers, and be involved in crazy amounts of drama. Our server offers… ↦ Social media channels for your OCs to text and post whatever they are feeling. ↦ Tons of channels for every type of roleplays. ↦ Slots for teacher and student OCs. ↦ Numerous sports and classes for your OC to be apart of. ↦ Intereactive lore and events that will keep things interesting. ↦ SFW and inclusive server for all. 𝐂𝐨𝐦𝐦𝐢𝐭 𝐭𝐨 𝐕𝐞𝐫𝐢𝐝𝐚𝐧 𝐇𝐢𝐥𝐥, 𝐲𝐨𝐮 𝐰𝐨𝐧𝐭 𝐫𝐞𝐠𝐫𝐞𝐭 𝐢𝐭.

Today's activity
1💬
14🟢
1👥
0📞
Server overview
87👥Total members
1📅years old
13+Age requirement
server profile pic
Inglorious Sovereignty
animegamescommunitysocialroleplay
user profile pic
thenuclearwarhead08-04-2024 03:47

Alot of cool emojis from jjk, csm, devil may cry, final fantasy and guilty gear

Description

A wonderous server full of people with multiple interests like gaming, anime, music, movies, sharing your hobbies and etc. this server has no rules because what you say shouldn't effect anyone. it should be no different from any conversations you have in real life. I pride myself in the fact this is indeed a multifandom server, i personally like media like pokemon and other games, aswell as movies like The crow or The punisher.

Today's activity
1💬
22🟢
1👥
0📞
Server overview
49👥Total members
1📅years old
13+Age requirement
server profile pic
Against the Shadow || LOTR RP
fantasylord-of-the-ringslotrrole-playroleplay
Description

You’re walking under the eaves of the mallorn sentinel-trees, the silence around you is deafening as you approach a clearing to find a something unusual. You see an ancient mirror, covered in rich engravings and full of steaming water; a quiet mesmerizing hum comes from within. As you peer into its depths, you see a strange and wonderful vision. What do you see? The great feats of Beren and Lúthien, of Húrin, of Tuor and of Eärendil are distant legends, and the Free Peoples are under threat. Sauron was destroyed at the end of the War of the Last Alliance, or so it was thought. After two millennia of respite, dark forces have taken root again, and the Free Peoples are weakening. The Elves of the Woodland Realm and Lothlórien have come under attack from the fortress of Dol Guldur, once thought abandoned. Orcs have entered the realm of Khazad-dûm and are fighting with every ounce of their worth to wrest Durin's kingdom hall by hall. Orcs from Mount Gram are harassing the Greenfields of the Shire and wargs have come down from the mountains. The Witch-Realm of Angmar has been destroyed, but the Men of Gondor and the Elves of Lindon were unable to save Arthedain or their capital of Fornost, and the last holdout of old Arnor is fallen. Worse yet, the Ringwraiths have returned in force and retaken the dread land of Mordor from a sickening Gondor. As forces mass on either side, it is only a matter of time before the hard-won peace is shattered and war again consumes Middle-Earth. The Wizards are far afield, and the Heroes are off on distant adventures, so it falls to the ordinary people of the West to secure their lands from evil and to ensure a future for Elves, Men, Dwarves and Hobbits. Will you win a future for your children or allow the Enemy to return? Come and forge your path in Against the Shadow! We have... ➸ A friendly server staff! ➸ Active members! ➸ Lore galore! ➸ Partnerships! ➸ Over 400 channels to roleplay in!

Today's activity
1💬
7🟢
1👥
0📞
Server overview
9👥Total members
2📅years old
13+Age requirement
server profile pic
Attack On Titan: New Horizons
animeaotattack on titandiscord roleplaydiscord-roleplaydrproleplay
Description

Hello! Welcome to the Attack On Titan: New Horizons Discord Server! We are a roleplay server that focuses mainly on the anime "Attack On Titan", we focus on bringing you the best AOT Roleplay experience possible to you. We allow any type of roleplayers, be it literate, semi-literate or non literate. We just want to give you the best roleplay experience for an Attack On Titan roleplay. (PTK Is off, RTK is on in this server by the way.) Give us any suggestions you may have! Also canon characters not allowed, entirely OC-Driven.

Today's activity
1💬
13🟢
1👥
0📞
Server overview
42👥Total members
2📅years old
13+Age requirement
server profile pic
Water Time 💦
roleplaysocialchillfriendsanimehangoutminecraftfantasyliteratepoliticsgamesmusicartcommunitysfwfriendlygamingfunvoicedatingwritingfurry
Description

Let's keep connected! The focus of this server is to bring people together and build an exciting community! ✅

Today's activity
1💬
32🟢
1👥
0📞
Server overview
71👥Total members
2📅years old
13+Age requirement
server profile pic
WHERE THE WIND LEADS.||multifandom au
multifandomroleplaymultifandom roleplaycrossover
Description

Where The Wind Leads is a multifandom/crossover slice of life AU! We allow nearly anyone to be added.

What we offer:
-A relaxed roleplay environment with a decent OOC section.
-An optional internet category.
-Simple, moldable lore moved by character interaction!
-Newly revamped, with a dedicated mod team and fun community!
15+ community with a strict NSFW policy.

We hope to see you here!
Bot count: 14
https://discord.gg/PCSxVCeCED
if either link does not work dm jonmartins

BEGGING OF YOU PLS PLS JOIN WE ARE AWESOME AND COOL <— biased owner

Today's activity
1💬
34🟢
1👥
0📞
Server overview
69👥Total members
2📅years old
15+Age requirement

210 servers found