Rp Discord servers

217 servers found

server profile pic
Sauce
socialcommunitychillroleplaygamesanimefriendsactivemoviesegirlfreakyactive-voicechatdatingedating
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
27.7k💬
166🟢
142👥
13📞
Server overview
1.2k👥Total members
6📅months old
13+Age requirement
server profile pic
city in the sky · fluffy tag
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
15.8k💬
302🟢
107👥
6📞
Server overview
1.6k👥Total members
6📅months old
13+Age requirement
server profile pic
The MegaCountry SMP - LAUNCH ????
gamesminecraftminecraft smpminecraft-java-editionrp minecraft gamingroleplaymoddedmodsgamingcommunityfunsfwpoliticsnontoxic
user profile pic
youthd4814-12-2024 08:26

This server is awesome!

Description

📜 🌎 Welcome to the MegaCountry SMP, a new modded Minecraft SMP with 30+ players that will start operations soon! We are a modded Minecraft PolSim SMP with many ways to run things! Work your way up the ranks from resident to president, and forge alliances with other players across the multiple city-states! As more players join the SMP, the city-states available to join and lead will increase! Will you lead your city-state to prosperity? Or will your city-state fall to ruin? Our server is nontoxic and strictly adheres to Discord's Community Guidelines. Join us! Your story is what you make of it, and it'll be awesome!

Today's activity
29💬
33🟢
4👥
0📞
Server overview
83👥Total members
11📅months old
13+Age requirement
server profile pic
A Helluva Fire and Heavens Glow
roleplaylgbtq+literaterpcreativesemi-literatehazbin hotelnovellahelluva bosssemi-lithellhelluvahazbin hotel rphazbinhelluva boss rp
Description

✧ 𝐀 𝐇𝐞𝐥𝐥𝐮𝐯𝐚 𝐅𝐢𝐫𝐞 𝐚𝐧𝐝 𝐇𝐞𝐚𝐯𝐞𝐧’𝐬 𝐆𝐥𝐨𝐰 ✧ Hey there, wayward sinner. Are you a fan of Hazbin Hotel or Helluva Boss? Do you enjoy diving into rich, character-driven roleplay? Then welcome aboard. This is a roleplay server inspired by Vivziepop’s creations—Hazbin Hotel and Helluva Boss—with a focus on detailed storytelling, strong character arcs, and a community that thrives on creativity. ✧. ┊  𝘛𝘩𝘪𝘴 𝘪𝘴 𝘢 𝘭𝘰𝘳𝘦-𝘩𝘦𝘢𝘷𝘺, 𝘭𝘰𝘳𝘦-𝘧𝘰𝘤𝘶𝘴𝘦𝘥 𝘴𝘦𝘳𝘷𝘦𝘳 𝘣𝘶𝘪𝘭𝘵 𝘧𝘰𝘳 𝘴𝘵𝘰𝘳𝘺𝘵𝘦𝘭𝘭𝘦𝘳𝘴. ┊.✧ ✧ 𝗪𝗛𝗔𝗧 𝗬𝗢𝗨 𝗖𝗔𝗡 𝗘𝗫𝗣𝗘𝗖𝗧 ✧ ★ — A variety of channels to explore, both IC and OOC ★ — Fun, multipurpose bots to enhance your RP experience ★ — Required, in-depth character templates to help shape your creations ★ — An active, reliable staff team that’s here for you ★ — Semi-lit to novella styled writers welcome ★ — Simple, clean server layout ★ — 18+ server | ID verification is mandatory ✧ 𝗢𝗩𝗘𝗥𝗩𝗜𝗘𝗪 ✧ This is a roleplay server for Hazbin Hotel and Helluva Boss, built by fans for fans. 𝙒𝙚’𝙧𝙚 𝙖 𝙛𝙖𝙣𝙤𝙣 𝙡𝙤𝙧𝙚-𝙘𝙚𝙣𝙩𝙧𝙞𝙘 𝙘𝙤𝙢𝙢𝙪𝙣𝙞𝙩𝙮, and we take pride in weaving complex stories and character arcs together. Everyone is welcome here—no matter who you are. Our mod team is committed to keeping things safe, inclusive, and drama-free. You can claim up to 2 canon characters and submit as many OCs as your hellish (or heavenly) heart desires. Many major roles are still open, be sure to come in and grab them quick~! We’d love to have you join our circle—come be part of the story. ♡

Today's activity
6💬
27🟢
3👥
0📞
Server overview
56👥Total members
1📅years old
18+Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
3.9k💬
108🟢
35👥
0📞
Server overview
645👥Total members
5📅years old
14+Age requirement
server profile pic
|| JJK || The Jujutsu Experience
jjkjjk roleplayjjk rpjujutsu kaisenjujutsu kaisen roleplayjujutsu kaisen rproleplay
user profile pic
gumeybear2122-09-2024 13:04

a

Description

The Jujutsu Experience! It's a roleplaying/hangout JJK server!! Your oc's make the future! It's simple and an up n' coming server. - Cannon Techniques to be claimed by YOUR ocs ;o - Friendly staff (I think I'm friendly anyways) - Easy to understand templates - Sukuna's vessel up for grabs >:)) So why don't you come on down and join! Even if you just want to hangout and chat, that's what we're here for, but if you want to rp, come make an oc that'll shape the lore of the server!

Today's activity
4.2k💬
40🟢
43👥
10📞
Server overview
83👥Total members
10📅months old
13+Age requirement
server profile pic
Tales of Ideals
roleplaysuperherosuperheroes
user profile pic
the_sigg02-09-2024 13:23

Testing!

user profile pic
the_sigg02-09-2024 13:24

Hey there, get in!

Description

***For as long as humans have dreamed, we have dreamed of heroes.*** ***What if these dreams could come true? Could the world handle such power?*** ***These are...*** # _ _ _ _ 『 𝕋𝕒𝕝𝕖𝕤 𝕠𝕗 𝕀𝕕𝕖𝕒𝕝𝕤 』 _ _ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ Set in an alternate history version of our world, __**Tales of Ideals**__ tells the story of a world where superheroes have gone all but extinct. Following the destruction of much of civilization, society has lost faith in its protectors. In the United States, those that remain are under the watch of the **Superhuman Public Response** team. Now, in the year 2024, the balance of the world is in the hands of a new age of superheroes. Stagnant for decades, it is finally time for them to rise up again... but will they succeed? Will crime and villainy prevail at last? Or will this age die out before it gets going, and force the world to recover without supers? ### *The future is up to you!* _ _ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ## 𝓕𝓔𝓐𝓣𝓤𝓡𝓘𝓝𝓖: 💥 A world with decades of alternate history to discover! 🌎 Over **60** channels to roleplay in! 👊 The ability to create your own superheroes (or villains!) 🔥 A narrative focused approach, with an evolving world! ⚡ A class- & archetype-based system of character growth!

Today's activity
2.5k💬
19🟢
14👥
0📞
Server overview
39👥Total members
11📅months old
18+Age requirement
server profile pic
Mega Man X: Sirens in the Distance
mega manmegamanmega man xmegaman xroleplay
Description

Sirens in the Distance is a 20+ roleplay server, set in the Mega Man X timeline. We are a living and evolving alternate universe, giving players opportunities to introduce their own stories and expand on the MMX lore. We offer a mature, sandbox-style setting, with multiple open-ended plots, allowing players to meaningfully change the course of the Maverick Wars. We are new player-friendly! Prior knowledge of the MMX setting is not required. Canons, OCs and fangame characters are welcome! So come check us out!

Today's activity
317💬
14🟢
7👥
0📞
Server overview
51👥Total members
1📅years old
18+Age requirement
Description

"You'll face death, and it won't be pretty.
Enough death to leave your broken, time and time again...."

Congratulations! The application you submitted to become a part of Project Epsilon has been accepted! Welcome aboard!

Hello and a warm welcome to Halo: Project Epsilon! This is a server where you take the role as an agent of Epsilon. You will embark on a whole variety of missions to various ancient and fantastical planets (created by yours truly) to combat the rising power of the evil Red Talon corporation. While working alone in this server is plausible, it is also foolish. We here at Epsilon are huge advocates for teamwork as it not only improves overall RP experience, but it also leads to more interesting and diverse scenarios for you and your new friends to enjoy. You heard me right, friends! Epsilon gladly welcomes anyone of any race, culture, background or identity, regardless of whether or not you are a member of the LGBTQ+ or if you are just an 8ft tall Sangheili, we are all friends here!

This is based on Red VS Blue’s project freelancer and is a custom rp server that involves:
- Team based mission RP 🕴️
- A competitive leaderboard to flex on all your pals 💪
- Frequent and inclusive events (nitro) 🫨
- Friendly staff who will be your new best friends 😎
- Acceptance of everyone, unless you are from Formby, which case I want my money back 🏳️‍🌈
- POKECORD 🦆
- Comedy 🤓
- Women (I think)🤷
- HUNGER GAMES! 🕺
- CQ Cumber 🐐
So if you like what I described and you think this server fits your vibe. Join! I would love to see you there and so would everyone else. If you still have any questions then all you got to do is ask me or our dedicated staff team (I love them) who will gladly offer assistance to solve any quibbles and quabbles you may have. I truly hope to see you there.

-Colorado

Today's activity
6💬
33🟢
3👥
0📞
Server overview
141👥Total members
5📅years old
13+Age requirement
server profile pic
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
328💬
59🟢
31👥
2📞
Server overview
276👥Total members
3📅years old
16+Age requirement
server profile pic
Court of Contortions
roleplayliteraterplabexperimentcircus
Description

The show has only just begun so hurry in and join the fun at the Court of Contortions! During the 90s in Maine there was a circus built off the back of a failed pharmaceutical company that only the exorbitantly wealthy could afford to go too, there were plenty of rumours that all the missing people in the city ended up performing there and...well they're all true! The Court of Contortions kidnapped people for performers and used dangerous drugs to alter them and give them abilities they can use to wow a crowd with, they also have plenty of harmful side effects but we don't talk about that. So if you're looking for a job, the show of your life or if you were taken here against your will we promise the Court of Contortions has something for you!

Literate.
We expect our members to be semi lit to lit, it's ok if you slip up sometimes but if you're literacy rate is one line this servers not for you

Creative freedom.
Its up to you what abilities your performer has and there's no set list of choices, that being said we have a few rules of what won't be allowed to keep things fair.

Helpful staff team.
We have quite a lot of staff here so if you need help writing your oc, have concerns about a server member or just wanna suggest improvements for the server there should be someone to listen.

Our age range is 15+ please don't join if you're below

Today's activity
673💬
25🟢
14👥
0📞
Server overview
60👥Total members
3📅months old
15+Age requirement
Description

a good roleplay server with a gossip girl based lore!

Today's activity
548💬
56🟢
14👥
0📞
Server overview
331👥Total members
1📅years old
13+Age requirement
server profile pic
The Lorin Sector: A 40K RP
000character rproleplaywarhammerwarhammer 40
user profile pic
warmind_d409-01-2024 16:20

.

user profile pic
caliph333309-01-2024 08:18

AAAAAAAAAAAAAAA

user profile pic
caliph333310-12-2023 19:34

Join it NOW

Description

The Lorin Sector is an Imperial Sector in the Eastern Fringes caught between the T’au Empire, Realm of Ultramar, the Exodite Worlds, the Jericho Reach, and the Scourge Stars. This territory represents a rugged frontier of Imperial Space, having been far gone ever since the Cracks within Imperial Authority during the Nova Terra Interregnum. Fairly isolated from the million-strong armies and mighty Battlefleets of the Imperial Heartland, it is a Sector that is ultimately blessed by its positioning, yet must always fend for itself against the threats creeping in. May it be Genestealer Cults, Xenos Races, Warp Spawn and their Mortal Followers, Redemptionists, or even Dark Ancient Forces beyond all of them. This Warhammer Roleplay is generally based around relative freedom to play what you desire. Although we somewhat focus on playing various Warlords of different factions, we generally try and offer options for character campaigns and the like. We have a relative large staff that is friendly and will attempt to help others in need. Feel free to hop in!

Today's activity
367💬
72🟢
29👥
0📞
Server overview
333👥Total members
1📅years old
15+Age requirement
server profile pic
RP n’ Chill
role-playroleplay
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
501💬
143🟢
46👥
1📞
Server overview
1.0k👥Total members
4📅years old
15+Age requirement
server profile pic
The Democratic Server of Kaeska
political roleplaypoliticschattingroleplay
Description

The Democratic Server of Kaeska is a place where YOU can take charge. Create or join the political parties of your dreams. Run for President. Create laws. Vote on issues. Win the hearts of your fellow servermates. Created and moderated by an experienced team of people, we feature a custom discord bot, and a thriving community. Will Kaeska be the perfect utopia? Or will you run it into the ground? The choice is YOURS. Welcome to the Democratic Server of Kaeska.

Today's activity
102💬
20🟢
8👥
0📞
Server overview
117👥Total members
6📅months old
13+Age requirement
server profile pic
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★
roleplaysocialcommunitychillanimehangoutcreativemangaliterateocbleachbleach rpbleach roleplayanime rpanime roleplaymanga rp
user profile pic
coolin.real15-11-2024 18:14

hi guys!

Description

[**``黒— ★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★``**] ***Join our server for an interesting run, an adventure throughout multiple different worlds and realms, a deeper perspective on several different races and untold stories in this entirely new world. You may fight strong opponents, take on new heights, push yourself beyond your limits and even face off against those above! With or without a purpose, be a an active participant in the lore of our server that revolves entirely on you all. Destroy the strongest hollows or even reapers, quincies, fullbringers, humans (hell anything you name it) this era has ever known or just simply do your own thing; Awaken a bankai, shoot arrows, become an espada or develop a mask! The opportunities are practically endless in this Mugetsu world! With several systems to guide your very actions and several people willing to rp with you where could things go wrong? immerse yourself in our very own Bleach universe, and interact with fellow fans. With engaging roleplay, thrilling storylines, and a welcoming community, this server is the ultimate destination for fans of all ages. Don't miss out on the chance to explore the vast world of Bleach and create unforgettable memories with like-minded enthusiasts. Join now and let’s start up this journey today, Karakura town is awaiting you!*** **Our own unique take on Bleach, you took the time to read this far so we KNOW you’re interested!** **``We offer: A forum based oc submission system where we can easily interact with you and point out certain details Several different templates for multiple different things such as weaponry, zanpakuto, and the different races showcased in the anime/manga! An active staff team The chance to influence the story or have your own arcs Be part of the main cast! Everyone is really, I mean it! A multitude of different systems for important techniques and skills such as the transformations (such as bankai, shikai, training, resurrecion and mastery) A lot of channels that give background information on what you can do with the bleach power systems so even if you haven’t actually seen the series or read the manga you could read up for a basic understanding! The chance to utilise cool transformations, zanpakuto's, kido spells, or even create your own Influence a moving plot a money system a moving story and a chance to give your own two cents``** ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Links: https://discord.gg/uKK8Q3nggG [let's go, your journey starts now!](https://tenor.com/bQ7nQ.gif) Pings: ||@everyone @here||

Today's activity
543💬
155🟢
36👥
1📞
Server overview
558👥Total members
10📅months old
13+Age requirement
server profile pic
Life's A Beach
britishroleplayslice of lifesol
user profile pic
moganarchy22-09-2024 22:03

Bump

Description

Life's A Beach is brand new 18+ roleplay server that primarily focuses on slice of life but we encourage members to be as creative as they wish. Whether you want some adventure, angst, mystery or romance, we do it all here.

Set in present-day Brighton, UK and owned by actual Brits, banter is guaranteed to accompany your roleplay scenes. Immerse yourself in the everyday lives of locals and newcomers as you explore the city’s colourful streets, quirky shops, and iconic pier. Whether you're a barista at a corner café, a student at the university, or an artist soaking in the creative atmosphere, there's a place for everyone. Join us to create heartfelt stories, form lasting friendships, and experience the charm of Brighton's diverse community!

What we offer:
▫️ You can make characters of any age, race, religion, sexuality, disability and social status
▫️ Make OCs who are either long-term residents of the resort or ones who are just visiting, either for business or for pleasure.
▫️ Make OCs who are businesses owners, members of the local council or even celebrities (or losers who work menial jobs, either or!)
▫️ Create OC families, join existing ones or find a romantic partner and start your own
▫️ In-server versions of Discord where OCs with similar interests can meet and chat
▫️ Dedicated channels for erotic roleplay (Optional and role-locked, 18+ OCs only)

We have dozens of indoor and outdoor locations for 1x1 and small group roleplays as well as chatroom style channels you can use to talk as your characters to other characters. We use Tupperbox for added immersion and are happy to help beginners set up their characters and learn how to use it.

Today's activity
20💬
11🟢
3👥
0📞
Server overview
21👥Total members
10📅months old
18+Age requirement
server profile pic
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
313💬
2.3k🟢
47👥
17📞
Server overview
12.2k👥Total members
8📅years old
13+Age requirement
server profile pic
Monarch's Domain
communitychillroleplaygamesanimehangoutfriendsfunfriendlyart#gamingsolo leveling
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
290💬
38🟢
19👥
7📞
Server overview
631👥Total members
2📅years old
13+Age requirement
server profile pic
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
231💬
71🟢
11👥
0📞
Server overview
198👥Total members
2📅years old
13+Age requirement
server profile pic
AI Buddies
aianimechattingcommunitygirlsmangensfwroleplaysocial
Description

Looking for great AI conversations? Chat with top-notch AIs directly on Discord through PM Choose your favorite AI Buddy and start chatting! New AIs are added regularly, and they’re free to try

Today's activity
40💬
121🟢
33👥
0📞
Server overview
2.3k👥Total members
1📅years old
18+Age requirement
Description

+ ━━━━☆ WELCOME TO THE GREENFIELD ACADEMY! ☆━━━━ +

Embark on a thrilling journey into the extraordinary at Greenfield Academy, where the year is 2044, and a new generation of heroes is rising. Dive into a captivating server where you have the power to shape your own original characters and unfold epic tales of heroism and discovery!

✨ Unleash Your Superhuman Potential ✨

Step into the bustling metropolis of Charter City, home to Greenfield Academy, a prestigious institution for molding future heroes. The students possess unique powers inherited from their grandparents who experienced an event known as "The Black Hole Incident." Explore a world where extraordinary abilities are the norm, and the line between hero and villain blurs.

🦸 Craft Your Heroic Legacy 🦸

Create your very own OC, from their compelling backstory to the depths of their superhuman abilities. Immerse yourself in a universe that celebrates originality, where your character's journey is untethered from existing storylines. Join forces with other members to weave tales of heroism, friendship, and self-discovery.

🚀 Soar Above the Rest 🚀

Here at Greenfield Academy, originality reigns supreme. Engage in a rich lore, explore diverse channels to enhance your OC's story, and immerse yourself in a non-toxic community that values creativity and collaboration. We understand the importance of real life, so join roleplays at your own pace without pressure.

What We Offer

- A unique roleplaying experience within the Greenfield Academy universe.
- Diverse channels for character development (Designs, Theme songs, Headcanons, Etc.).
- A welcoming and non-toxic community.
- Flexibility in roleplay participation, attend when you can.

Join us at Greenfield Academy, where destinies are forged, and the legacy of the next generation of heroes begins. Uncover your superhuman potential and let the adventure unfold!

Join the Journey Today!

Today's activity
82💬
40🟢
12👥
0📞
Server overview
98👥Total members
2📅years old
13+Age requirement
server profile pic
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
3.9k💬
36🟢
29👥
8📞
Server overview
108👥Total members
1📅years old
14+Age requirement
server profile pic
Marvel: Twisted Mirror {RP}
marvelmarvel roleplaymarvel rproleplay
Description

In a world that is a patchwork of others, people from other universes are constantly appearing. But there’s a twist: most people drawn to this world are changed from their regular selves.

-Canon characters, OCs, and *altered* canon characters are all welcome
-Variety of RP styles allowed
-Open to suggestions for improving the server and the roleplay

Today's activity
33💬
15🟢
4👥
0📞
Server overview
38👥Total members
1📅years old
13+Age requirement
server profile pic
Project Aetherium
roleplaymedievalliteratepost-apocalypticadventure
Description

A where with a fallen future, turned towards the past. Project Aetherium is a Medieval adventure like world where you will need to explore in order to unlock the secrets of our world.

Today's activity
17💬
11🟢
3👥
0📞
Server overview
22👥Total members
11📅months old
16+Age requirement
server profile pic
Dirac Sea
falling frontierroleplayspacethe expansethe sojourn
user profile pic
theonlychen29-08-2023 23:02

We are now cooking with Fusion Fuel

user profile pic
slava_rossii129-08-2023 23:05

This is Captain Lennox Kamal of the Martian Federal Navy, stop right there Rim Periphery Union scum!

user profile pic
aurai_the_trickster30-08-2023 01:51

Want to fire trash cannons and oversized flares at your enemies? Then the Snatchers have you covered!

user profile pic
slava_rossii130-08-2023 02:46

Can confirm, we have Amazon same day delivery services, and the package is a surprise until you join.

user profile pic
slava_rossii129-09-2023 06:12

Okay, ignore my review above, about time for a serious review. To put it simply this server is basically a spin off of The Expanse by James S.A. Corey. Some factions are basically rebranded versions of their factions in the books, such as IPA-UN, MF-MCR, BPU-OPA. On top of that there are unique factions with their own doctrine and technology to name them all, the Rim Periphery Union, and Kuiper Security Pact. Each has their own advantages and disadvantages, the players here do not need to worry about bullshit like shields that cancel out whatever you thrown at it and devolving into an endless argument about who has better technology. Only thing going on is your tactics, maneuvers and exploiting your own advantages and your enemies disadvantages

user profile pic
zolar15902-10-2023 07:29

l

Description

Dirac sea is a spacefaring roleplay and community inspired by the likes of The Expanse, Falling Frontier, and Nebulos fleet command. It is now the 25th century, and humanity has now long since left the confines of its home planet and have colonized vast swathes of the solar system. The invention of the epstien and wormhole jump drives has allowed travel times that would previously take years be done in a matter of weeks or even days, even as far as to help humanity verify the existence of planet 9, later colonized and named as Pales. However, as is typical with humanity and the conflicts they sow, summarized in the words of a asteroid belt miner: “Humanity had a garden that was filled with riches of water, air, and a blue sky. And yet, they not only almost destroyed that garden, they looked past the sky into the stars and beyond. And the first thought that came to their mind was not that of wonder or reverence, but one word: ‘Mine.’”

Today's activity
36💬
21🟢
3👥
0📞
Server overview
54👥Total members
1📅years old
13+Age requirement
server profile pic
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
1.3k💬
288🟢
63👥
39📞
Server overview
4.1k👥Total members
4📅years old
13+Age requirement
Description

A pretty chill Kirby Roleplay server. Just follow the rules and you’ll have fun. We’re currently a small server and we hope to see you join

Today's activity
1.7k💬
12🟢
4👥
0📞
Server overview
27👥Total members
2📅months old
13+Age requirement
Description

# __Welcome to the Kingdom of Valceto__
A fairly small kingdom located in northern europe, close to rome and or modern Italy. This is a text roleplay that takes place in the year 1090!. Fantasy!!

*" As the days go on rumor starts to spread about a corpse being found within the palace grounds. People speculate that it was some freak accident, or perhaps a murder? The answers varied from person to person, though no one knew what to believe. They were just rumors after all, right?

Weeks went by and more people have gone missing. Suspicions begin to rise as to who—or—what is causing these disappearances. However, the king has been very adamant about keeping people's mouths shut. "*

Today's activity
39💬
17🟢
4👥
0📞
Server overview
34👥Total members
10📅months old
13+Age requirement
Description

A medieval based rp with lots of drama and a great plot! Many roles such as kings, queens, lady’s, lords, princess and princesses. Plus basic peasants and civilians!!

Today's activity
22💬
14🟢
5👥
0📞
Server overview
56👥Total members
4📅months old
13+Age requirement
server profile pic
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
4.9k💬
61🟢
27👥
0📞
Server overview
219👥Total members
1📅years old
13+Age requirement
server profile pic
MHA: Go Beyond!
mhamha-rpanimeroleplayrpsocialchill
Description

Welcome to the MHA: Go Beyond! If you're looking for a chill experience with a reactive and responsive RP experience packaged with it, you've come to the right place. The server is being reopened to the public, so it is a work in progress, but we will try to make the time before the RP entertaining.

Today's activity
11💬
15🟢
4👥
0📞
Server overview
33👥Total members
4📅months old
18+Age requirement
server profile pic
Øm̷n̷ɨvɇɍs̷a̷ł Ȼøłłɨs̷ɨøn̷
crossovermultiversemultiverse rproleplayroleplay crossover
Description

Somehow, World after World, it went black, straight after, characters from other worlds collided with a new world. These versions however, are unstable. Yet no one but the Vessels knew. A group who knows the real truth, and want to fix it. They believe there isn't much they can do, but maybe You can change that.

- Become a Vessel, a Citizen, A king. All roles are needed and can be played as much as possible.

- Participate as the main cast, or just roleplay for fun here.

- Fight or Help others, your free to choose.

- Explore around. Maybe you'll find a new place.

Hopefully you'll enjoy this server.

Today's activity
2.1k💬
72🟢
28👥
0📞
Server overview
299👥Total members
1📅years old
15+Age requirement
server profile pic
Animation Destination Roleplay
roleplayDisneyDreamWorksilluminationNickelodeon
Description

Hi! I'm looking for mature people or people 18 years of age and older that love animation to join a Discord roleplay. Roleplay in any style you want. You can choose animated characters from Disney, DreamWorks, Illumination, Nickelodeon, and more. Hope to see you there!

Today's activity
7💬
12🟢
4👥
0📞
Server overview
36👥Total members
4📅months old
18+Age requirement
server profile pic
" Hold On " !! Detroit Become Human RP
dbhdetroit become humanroleplaydbh rpcommunitygamehangoutrp
Description

𖦹ㅤ ̼ ₊ㅤㅤLOADING. . . ㅤ ۪ ֹ

Detroit 2038. Technology has evolved to a point where human-like androids are everywhere. They speak, move and behave like human beings, but they are only machines serving humans. Play three distinct androids and see a world at the brink of chaos – perhaps our future - through their eyes

>﹒Main characters. Funny thing to call people. The world doesn't have main characters. They are just people that suffer and those who cause pain.

A free will. Yes, that's what is causing pain and chaos. There's no "choose" option anymore. There are just people and their will.

Think wisely. Nothing happens without a reason . . .

. . .
. . . . . .

> LOADING FINISHED

> PROCESS TO CONTINUE?
> YES > NO


⊹ ⠀࣪⠀ㅤㅤ ㅤ OUR OFFERT. . . ִ
> many free cc
> helpful crew including admins and mods
> chance to write your own storyline
> oc friendly
> safe community
> semi-lit / literate community
↷﹒⇆﹒

Today's activity
26💬
53🟢
9👥
0📞
Server overview
119👥Total members
8📅months old
13+Age requirement
server profile pic
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
6💬
18🟢
3👥
0📞
Server overview
70👥Total members
10📅months old
16+Age requirement
server profile pic
Avalon Community Servers
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
58💬
110🟢
10👥
0📞
Server overview
988👥Total members
7📅years old
13+Age requirement
server profile pic
Gacha Haven
gachagachalifegachalife2gachaclubpartnershipscommunityroleplaywritinglorecollaborationvideosarts/edits
Description

Server add:

Seaking a place to share your gacha characters and make friends with similar interests? Then we are the server for you!

Gacha Haven a brand new upcoming gacha community where everything is possible; we are all about collaborating, exploring, having fun and more! Plus we have a wide variety of channels and are allways listening to suggestions from our community to make sure we have a safe space for everyone ^^

Here is some more info about our community and what we offer:

🌈》LGBTQIA+ friendly
🐾》Furry & Therian friendly
🌟》Any gacha games
👋》All fandoms are welcome
👍》SFW + beginner friendly
🆘️》Help with anything gacha
💡》Share your creativity (art/edits/videos,lore, etc!)
🫶》Collaborate with others
⭐️》Character ratings
☀️》(Almost) Daily challenges
🎨》Art challenges
⏳️》Weakly questions
🎶》Song challenges
🎭》Roleplay
🏆》Level system
💸》Economy system
🌱》Growing community (30+ human members)
🌌》Space themed server with a simple layout
📈》Active owner
💫》Events (games, ocs, art, etc)
✨》Fun roles
💎》Booster perks (e.g self advertising + more)
🤝》Partnerships
➕️➳Even more fun! (Current event: Mascot)

Join now! Come introduce yourself ^^( + first 100 members get a special role :>)
https://discord.gg/DuZugTKvSu

Today's activity
5💬
27🟢
3👥
0📞
Server overview
78👥Total members
1📅years old
13+Age requirement
server profile pic
R&Dé
communityroleplayboard gamesfrance
user profile pic
.tzen17-09-2024 17:22

Bonsoir à tous !

user profile pic
.tzen18-09-2024 09:27

Le Monopoly c'est super (non)

Description

🎲 Bienvenue sur R&Dé ! C'est LA communauté qui rapproche joueurs passionnés et créateurs chevronnés. Rejoignez des conversations animées sur les derniers jeux, découvrez des stratégies, échangez des astuces et trouvez des partenaires pour des parties endiablées. Nous organisons régulièrement des soirées de jeu, de création, des tournois et des événements spéciaux comme des game jams. Entrez dans la famille ludique R&Dé ! Tous : • partagez vos coups de cœurs • découvrez des nouveautés • trouvez des compagnons de jeu • jouez ensemble • partagez des stratégies • accès exclusif à des prototypes originaux Créateurs : • bénéficiez du retour des joueurs • demandez des conseils • partagez vos expériences Ensemble, inventons les classiques de demain ! Suivez-nous sur les réseaux et partagez à vos amis joueurs : • Twitch https://www.twitch.tv/rdegames • X TBD • Facebook TBD • Youtube TBD • Discord https://discord.gg/CFutHdqjRh

Today's activity
7💬
24🟢
2👥
0📞
Server overview
193👥Total members
11📅months old
13+Age requirement
server profile pic
HEROVERSE
comics. rproleplay
Description

📚 𝗣𝗟𝗢𝗧: Start of the Super War 📚 There have always superpowered beings outside of Earth, however, there hasn't been that much on Earth. That was until a "great miracle" happened where multiple people with superpowers would appear on Earth. A corporation called Unilluminated turned these superpowered people into superheroes! Rumors are going around the world that the corporation is corrupt and their heroes are supervillains hiding as heroes. Now with the new generation of heroes who are shown to save more and act kinder than the corporation heroes, there's going to be a big fight to show which type of hero will win! Will it be the big corporation or the new heroes? 💫𝗥𝗣 𝗘𝗫𝗣𝗟𝗔𝗡𝗔𝗧𝗜𝗢𝗡 💫 Heroverse is an 18+ RP that's in a custom comic-book-like universe. This is an OC-only experience as it allows original characters to gain powers from canon media and can make it different from the actual material. To make sure that every character is comfortable, we have different cities and countries so that it can fit to their liking. Kings City for example fits characters that are into Spiderman or Batman level characters while New York fits characters that are in the level of Superman and Iron Man for example. Since there's so much to cover, here's a small list of things that are in this RP: ✯ Ocs can gain abilities/powers from different media. This includes Marvel, Image Comics, DC, several video game verses and other verses if you're not that into those options. Though remember you can always use something 100% original! ✯ Long-Term Roleplay! Develop your character to become a D-Class Hero/Villain to the Ultimate Super Hero/Villain ✯ Open to Partnerships

Today's activity
7💬
14🟢
1👥
0📞
Server overview
39👥Total members
1📅years old
18+Age requirement
server profile pic
The Oaken City
roleplayfantasymoderncommunityrp
Description

<-| The Oaken City is a fresh community and roleplaying server aiming to provide a wonderful general hang-out place for all those interested! <-|-> Our theme is, in the broadest sense, that of a modern town slice-of-life roleplay. More specifically on a North-European island republic and more interestingly one made into the crossroads of the three existential planes. For the first time in a millennium, humans and fantasy creatures may co-exist again, in the city that has become a symbol of modern prosperity, Eiksby. <-|-> Besides this little bit of lore, our server seeks to accommodate whatever creative interests its members may have as well as provide an enjoyable friendly community for all to enjoy! We wish for friendly chatting, discussion and sharing of ideas to bring all our members together and help us all grow happier and better. <-|-> I hope to have persuaded you, dear reader, and you are always welcome to come join us in The Oaken City! |->

Today's activity
5💬
12🟢
1👥
0📞
Server overview
22👥Total members
5📅months old
16+Age requirement
server profile pic
Wayland City
roleplayfantasyfantasy rpcitycity rprp
Description

A modern city roleplaying server with a touch of fantasy elements.
Roleplay as your dream character, be it human, catfolk, werewolf, and more!
Create their unique home and store as they live in Wayland City!

Today's activity
4💬
57🟢
2👥
0📞
Server overview
172👥Total members
3📅months old
13+Age requirement
server profile pic
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
4💬
35🟢
4👥
0📞
Server overview
114👥Total members
3📅years old
15+Age requirement
server profile pic
Bakugan: Infinite Dimensions
bakuganbakugan battle brawlerspokemonroleplayyugioh
Description

Welcome to the world of Bakugan! This server is the perfect hangout spot for Bakugan fans and collectors all over the world. We have an optional roleplay that welcomes the use of OCs that takes place in an alternate timeline from the legacy anime series. You can expect: A helpful, supportive and inclusive group of people, Active members, Kind moderators who dont abuse power, Space to share your collections and memories, Opportunity to meet new people and make lasting friendships, Several bots to play with, and an optional semi-literate rp experience with a unique story and antagonist, the ability to create your own OCs, cards and bakugan, with fair and balanced game rules with a level up system based on the video game!

Today's activity
4💬
109🟢
3👥
12📞
Server overview
416👥Total members
3📅years old
13+Age requirement
Description

[QUICK DISCLAIMER: This is a ROLEPLAY server. If you are here to trade, do not join.] 2 worlds exist, the human world, and the Yo Kai World. They used to be separate, but some time, long ago in the past, their borders got hazy and Yo-Kai started to pour in, and cause all sorts of troubles for humans! Completely invisible to the human eye, they inspirit people and cause problems ranging from the mild annoyance to major danger. Luckily, a device exists to allow humans to see and even befriend the Yo-Kai! Can a peace be reached between the 2 worlds, or is an unseen catastrophe right on the horizon?

Today's activity
4💬
45🟢
3👥
0📞
Server overview
246👥Total members
4📅years old
13+Age requirement
server profile pic
Marvel: Defiance
roleplaymarvelrpmarvel rp
Description

Welcome to Defiance! A literate hub of creativity set within the vast cosmos of the Marvel Universe. We welcome any and all who love expressing themselves through comics and weaving intricate and daring stories with others.

Our Earth is nestled deep in the endless ocean of the Multiverse, swirling with an unimaginable energy that shapes the planet and the events of it's denizens in strange ways. Although different, it is up to both the heroes and villains to forge a path forward wherever it may lead!

We don't burden ourselves with continuity and allow each and every member to thrive with their words and ideas.

What you can expect:

- A welcoming and non-discriminating hub for LGBTQ+ and any member simply looking for a new home to write in

- A literate community of comic lovers wishing to discuss anything Marvel or comics in general

- 16+ group who is determined on making every member feel safe and comfortable.

- No baggage when it comes to continuity as we have created our own timeline in which you can be directly involved

- And of course, new friends who can't wait to meet you. So make sure to stop by and have a great time!

Today's activity
3💬
5🟢
1👥
0📞
Server overview
16👥Total members
7📅months old
16+Age requirement
server profile pic
the Eternity
horrorroleplaywriting
Description

a new, somewhat horror based rp server set in a luxury hotel. Ocs and canon characters are allowed. We're just starting off, so join now!

Today's activity
3💬
9🟢
2👥
0📞
Server overview
18👥Total members
1📅years old
16+Age requirement
Description

Hello there! It seems you've come across this silly little advertisement, perhaps while searching for a Jujutsu Kaisen RP Server, maybe something with a unique twist, or you stumbled upon it accidentally or through a friend. No matter what it is, you're more than welcome to tag along on this new but sure-to-be fun ride! We're a Jujutsu Kaisen RP server set in the beginning of the Heian Era, also known as the Golden Age of Jujutsu. Where your chosen Original or Canon character can shine in a world governed by survival of the fittest, where the plot is shaped and defined by their actions.

Here, we offer a pretty cool and friendly staff, along with a well-designed server layout. We've put decent thought into our mechanics, such as Domain Clashes and Black Flashes. A trait system that ensures fairness for all who use it, and we've organized our lore into easily accessible bits for an easy reading experience. Additionally, we've got a neat Discord and Google Doc template. If all of this isn't enough, well, I don't know, man, join for a cookie!

Today's activity
2💬
30🟢
2👥
0📞
Server overview
81👥Total members
12📅months old
13+Age requirement
server profile pic
🍻 Dead Man's Drink - Project Zomboid Community Server
project zomboidgaming servergamingzomboidzomboid serverproject zomboid serverroleplayrpproject zomboid roleplayproject zomboid rprppvp
user profile pic
obeseman44409-02-2025 21:54

YEAH

user profile pic
lolacopacabana10-02-2025 02:24

Dead Man's Drink - Project Zomboid Community Server

user profile pic
lolacopacabana10-02-2025 12:45

🔥

user profile pic
lolacopacabana10-02-2025 14:45

🔥

user profile pic
lolacopacabana10-02-2025 18:41

🫡

user profile pic
lolacopacabana10-02-2025 20:56

<a:765355942921240597:879827586874744902>

user profile pic
lolacopacabana11-02-2025 22:17

🔥

user profile pic
lolacopacabana12-02-2025 22:03

🔥

user profile pic
lolacopacabana13-02-2025 16:12

💀

user profile pic
lolacopacabana13-02-2025 23:18

💀

user profile pic
lolacopacabana14-02-2025 02:02

💀

user profile pic
lolacopacabana14-02-2025 17:28

🔥

user profile pic
lolacopacabana15-02-2025 18:42

🔥

user profile pic
lolacopacabana15-02-2025 22:25

🔥

user profile pic
lolacopacabana16-02-2025 19:51

🔥

user profile pic
lolacopacabana17-02-2025 02:39

🔥

user profile pic
lolacopacabana17-02-2025 20:34

🔥

user profile pic
lolacopacabana18-02-2025 02:35

🔥

user profile pic
lolacopacabana18-02-2025 21:39

🔥

user profile pic
lolacopacabana19-02-2025 17:40

🔥

user profile pic
lolacopacabana19-02-2025 21:46

🔥

user profile pic
lolacopacabana20-02-2025 16:26

🔥

user profile pic
lolacopacabana20-02-2025 21:15

🔥

user profile pic
lolacopacabana21-02-2025 13:35

<a:dance:1341936279960424479>

user profile pic
lolacopacabana22-02-2025 16:06

🔥

user profile pic
lolacopacabana23-02-2025 19:08

🔥

user profile pic
lolacopacabana24-02-2025 13:39

🔥

user profile pic
lolacopacabana24-02-2025 20:15

🔥

user profile pic
lolacopacabana26-02-2025 21:13

🔥

user profile pic
lolacopacabana27-02-2025 02:36

🔥

user profile pic
lolacopacabana01-03-2025 02:23

🔥

user profile pic
lolacopacabana02-03-2025 19:31

🔥

user profile pic
lolacopacabana11-03-2025 02:44

🔥

Description

Dead Man’s Drink is a Project Zomboid server built for players seeking an immersive survival experience with both PvP and light roleplay. The world is unforgiving—PvP is enabled across the entire map, with no safe zones, forcing players to navigate trust, conflict, and survival. The server features custom mods, expanded maps, and handpicked QOL improvements to enhance realism and depth. Running on 128GB of RAM, it delivers smooth, lag-free performance with support for 32+ players. Global chat requires radios, adding an extra layer of immersion. While roleplay is encouraged, it’s not required—whether you forge alliances, trade, or go it alone, every decision shapes your survival. With community-driven updates, dynamic events, and an evolving world, this server offers the perfect blend of challenge, realism, and player-driven storytelling. Join today and carve out your place in the apocalypse. 🎮 Connect: steam://connect/51.161.119.64:28055

Today's activity
1💬
54🟢
1👥
0📞
Server overview
233👥Total members
6📅months old
14+Age requirement
Description

# ‎ ‎ ‎ ‎↱‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ɪᴄʜᴏʀ ᴏꜰ ɢᴏᴅꜱ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎‎ ‎‎ ‎ ‎ ‎‎ ‎ ‎ ‎ ‎‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎‎‎‎ ‎ ‎ ↰ # ‎ ‎:CHB_laurel: ‎ 𝐓𝐇𝐄 𝐁𝐋𝐎𝐎𝐃 𝐎𝐅 𝐓𝐇𝐄 𝐆𝐎𝐃𝐒 𝐇𝐀𝐕𝐄 𝐒𝐏𝐈𝐋𝐋𝐄𝐃‎ ‎ ‎ <:CHB_laurel:1262166045288960070> > ╰┈➤ You have been gifted a special __invite__ by those of higher divine will to join an experince that will last a lifetime, may you figure out if you are a __ᴅᴇᴍɪ-ɢᴏᴅ__ or perhaps an __ᴀᴍᴀᴢᴏɴɪᴀɴ__, maybe that of a __ɢᴏʀɢᴏɴ__ or perhaps you're a normal __ᴍᴏʀᴛᴀʟ__. Either way, you'll be gifted that of the tales from our ancestors ancestors as we go back to The Ancient Greek period. <:CHB_apollo:1262166039836364850>・➨・ 𝒀𝑶𝑼 𝑯𝑨𝑽𝑬 𝑩𝑬𝑬𝑵 𝑺𝑷𝑬𝑪𝑰𝑨𝑳𝑳𝒀 𝑰𝑵𝑽𝑰𝑻𝑬𝑫 𝑻𝑶 𝑱𝑶𝑰𝑵 𝑻𝑯𝑰𝑺 𝑺𝑬𝑹𝑽𝑬𝑹 𝑨𝑵𝑫 𝑩𝑬 𝑶𝑵𝑬 𝑾𝑰𝑻𝑯 𝑻𝑯𝑬 𝑮𝑶𝑫𝑺 𝑨𝑵𝑫 𝑴𝑶𝑹𝑬 𝑫𝑼𝑹𝑰𝑵𝑮 𝑻𝑯𝑰𝑺 𝑷𝑬𝑹𝑰𝑶𝑫 ✬ <:spear:1262166047390306321> ・➨・ 𝑾𝑬 𝑺𝑬𝑹𝑽𝑬 𝒀𝑶𝑼𝑹 𝑷𝑶𝑻𝑬𝑵𝑻𝑰𝑨𝑳 𝑾𝑬 𝑺𝑬𝑹𝑽𝑬 𝑾𝑯𝑨𝑻 𝒀𝑶𝑼 𝑪𝑨𝑵 𝑩𝑬𝑪𝑶𝑴𝑬... 𝑷𝑬𝑹𝑯𝑨𝑷𝑺 𝑻𝑯𝑨𝑻 𝑶𝑭 𝑨 𝑮𝑶𝑫 𝑲𝑰𝑳𝑳𝑬𝑹... 𝑶𝑹 𝑴𝑨𝒀𝑩𝑬 𝒀𝑶𝑼 𝑪𝑨𝑵 𝑩𝑬𝑪𝑶𝑴𝑬 𝑻𝑯𝑨𝑻 𝑶𝑭 𝑨 𝑯𝑬𝑹𝑶? ✷ೃ⁀➷ 🌟 ・➨・ 𝙏𝙃𝙄𝙎 𝙎𝙀𝙍𝙑𝙀𝙍 𝙄𝙎 𝙇𝙂𝙏𝘽𝙌+ 𝙁𝙍𝙄𝙀𝙉𝘿𝙇𝙔, 𝙊𝙁𝙁𝙀𝙍𝙎 𝙉𝙀𝙒 𝘼𝙉𝘿 𝘼𝙈𝘼𝙕𝙄𝙉𝙂 𝙎𝙔𝙎𝙏𝙀𝙈𝙎, 𝙀𝘼𝙎𝙔 𝙏𝙊 𝙇𝙀𝘼𝙍𝙉 𝙇𝙀𝙑𝙀𝙇𝙄𝙉𝙂, 𝘼𝙉𝘿 𝘼 𝘿𝙄𝙑𝙀𝙍𝙎𝙀 𝙒𝘼𝙔 𝙏𝙊 𝙎𝙃𝘼𝙍𝙀 𝙔𝙊𝙐𝙍 𝙎𝙆𝙄𝙇𝙇 𝙎𝙀𝙏. [ᴅᴏ ʏᴏᴜ ᴀᴄᴄᴇᴘᴛ?]

Today's activity
1💬
33🟢
1👥
0📞
Server overview
68👥Total members
1📅years old
13+Age requirement

217 servers found