Rp Discord servers

🔎 Search
🏷️ Tags
🔞 Age Requirement
📊 Sorting
👥 Server Size
📅 Server Age
🌍 Language
🎭 Vibes

202 servers found

Fluid Client Discord server profile picture
Fluid Client
communitysocialactivechillroleplaygaminghangoutgamescreativefriendsfunfriendlyartchatmusicvcsfwrobloxminecraft
Description

Ready to take your Minecraft adventures to the next level? Fluid Client, the unrivaled Minecraft client for 1.8.9, is your ticket to endless possibilities! 🌍 Unleash your imagination, conquer challenges, and build your way to victory! Download now at https://fluidclient.ovh/download.

Today's activity
19
14
0
Server overview
9.6kTotal members
3years old
13Age requirement
StarWars: RP Discord server profile picture
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
749
34
0
Server overview
274Total members
4years old
16Age requirement
It's Your Power! Discord server profile picture
It's Your Power!
roleplayrpmhamy hero academiamha-rproleplayingmy hero academia-roleplay)my hero academia-rppartnership
Description

🌟 IT’S YOUR POWER! — MY HERO ACADEMIA RP 🌟

🦸‍♂️ Do you have a hero OC?
🦹 A villain with a cause?
👤 Or a civilian just trying to survive in a superpowered world?

It’s Your Power! is a My Hero Academia–based roleplay server set in a post-war, hybrid timeline, where hero society is rebuilding—and redefining itself.

In this world, most humans possess Quirks, superhuman abilities that shape daily life, careers, and conflict. Hero schools still stand, villains still lurk, and the line between right and wrong has never been thinner.

What sets us apart?

✨ Play who you want.
You’re not limited to hero students. Play:
Hero students, Pro Heroes, Villains, Vigilantes, Civilians, Support and business roles
…and more.

🏫 Multiple Hero Schools

U.A. High School

Shiketsu High School

Deika City University (DCU) — a bold, experience-first hero institution

📖 Story-Driven World
The world reflects the consequences of canon events, while leaving room for player-driven stories, growth, and server-wide arcs.

🌈 Inclusive & Community-Focused
Whether you’re here for intense plots, character development, or casual RP, there’s a place for you.

🔹 What We Offer:

• Friendly and welcoming community
• Clear rules and active staff
• Self-assignable roles
• Open RP channels (no forum locking)
• RP events and story arcs
• LGBTQ+ friendly environment
• Unlimited original characters
• Canon characters available to claim
• Partnerships welcome

Step into a world where power doesn’t define destiny.

It’s not about the Quirk you’re born with.
It’s about what you choose to do with it.

💥 It’s Your Power! 💥

Today's activity
134
15
0
Server overview
214Total members
6months old
15Age requirement
the Eternity Discord server profile picture
the Eternity
horrorroleplaywriting
Description

a new, somewhat horror based rp server set in a luxury hotel. Ocs and canon characters are allowed. We're just starting off, so join now!

Today's activity
25
5
0
Server overview
17Total members
2years old
16Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
3.0k
41
0
Server overview
722Total members
6years old
14Age requirement
Description

ꕤ˖⸝⸝₊˚ Heiwa: 𝐆𝐨𝐥𝐝𝐞𝐧 𝐅𝐚𝐭𝐞 — a Medieval Fantasy Roleplay Server Long ago, the Epoch Shift shattered history; revealing a hidden orange-glowing moon, Nimiel, and changing the world as we know it. Civilizations now rise from the ruins, rediscovering old gods, lost kingdoms, and mysterious crystals embedded deep within the land. Ecosystems evolving far faster than we can keep up with, people redefining themselves and their lives. In this world, magic is a muscle, not an infinite force. Each spell strains the body. Power comes from training, endurance, and discipline. Your story begins here - when anything and everything you do can change the course of the story, how will you choose to live? 𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃 Heiwa is currently in a TRIAL PHASE. From now until NEW YEARS, the server is open for character-making and roleplaying, but no important lore events will occur. If you want to get in to make a mark before we truly kick off, now is the time! Deep, original lore (two moons, a shattered epoch, divine politics, unique magic system) Friendly, active community OC-focused, literate & semi-literate roleplay Medieval fantasy aesthetic Multiple regions, factions, and cultural paths Helpful staff, open channels for new players Event-driven storytelling + player-driven plots Safe, welcoming environment for all Ready to step into the new era? Join the world shaped by Mōna and awakened by Nimiel. Your story awaits.

Today's activity
775
23
12
Server overview
132Total members
7months old
13Age requirement
City in the Sky Discord server profile picture
City in the Sky
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
2.3k
50
0
Server overview
2.8kTotal members
1years old
13Age requirement
Echoes of Crystal Discord server profile picture
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
2.0k
26
10
Server overview
161Total members
2years old
14Age requirement
Divinity's Rapture Discord server profile picture
Divinity's Rapture
communityroleplayroleplayingchillsocialanimelgbtq+fireemblemfe3h18+anime rp
Description

(SFW RP, but hidden ooc nsfw channel)

(Past and "modern" versions of characters are, essentially, separate people, and exist at the same time.)

The year is 1885, nearly 700 years after the War of Unification for Fódlan. Peace and prosperity reigned across the land as students far and wide made their way to the esteemed officers academy. A professor awaits for a new opportunity to teach as three important heirs make their way to Garreg Mach alongside their comrades. Little did any of them know however the peace they knew would come crashing down. Those from the past arrived both friend and foe. While the newly lost Fell Star seeks to restore balance and preserve this world the King of Liberation and his allies move to conquer and destroy. For the past was never meant to encounter the future and the dead should have been left to rest. Memories blur as the inhabitants of Garreg Mach attempt to understand who they are and what this all entails.

(Welcome to Divinity’s Rapture! An FE3H time travel au featuring the messy attempts at finding a perfect ending and the consequences that follow. Follow the story as the past is flung into an alternate far future all while reality desperately attempts to piece itself together. )

Today's activity
11
4
0
Server overview
54Total members
1years old
18Age requirement
The Russian Language Discord server profile picture
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
821
54
2
Server overview
6.9kTotal members
5years old
13Age requirement
The Funnybunny Street Corner (21+) Discord server profile picture
The Funnybunny Street Corner (21+)
tadctadc rpthe amazing digital circusroleplaythe amazing digital circus rp
Description

WE ARE NEW! A 21+ roleplay server aimed towards people who wanna write and have fun! Here you'll find NPCs, OCs, partnerships, and game nights with friends! We have literate and crack roleplay channels as well as places to post all your wonderful media!

TAKEN CHARACTERS:
JAX
CAINE
POMNI
EVIL JAX

6 OC SLOTS OPEN!

COME JOIN AND BECOME THE DIGITAL DISASTER YOU WERE MEANT TO BE.

Today's activity
69
11
0
Server overview
35Total members
3months old
21Age requirement
Якудза Discord server profile picture
Якудза
socialchillgaminggamesworld of warcraftjapancommunityroleplayanimefriendsfunfriendlyartchatactivemusicmemesmoviesrpmangaeventsprogrammingcreativenon-toxicvoicechattingreading
Description

Невыносимые ограничения, дотошные лицемерные правила... Устали от всего этого? Ищете взаимопонимания? В нашем самом вольном объединении рады всем, кто на стороне Справедливости.
Вступайте в семью!

Мы - атмосферное сообщество, объединяющее людей разных фриланс-профессий, талантов и интересов. Наш оригинальный подход направлен на поддержание духа свободы и взаимопомощи.

На нашем уютном сервере вы найдёте:
✓ Приветливое сообщество фрилансеров с анкетами для работы
✓ Дизайнерскую стилизацию под японскую тематику с аутентичными картинками и философскими фразами с глубоким смыслом
✓ Уникальную демократическую систему политической жизни сервера с выбором клана
✓ Разнообразные чаты для вольного общения, игр и интересов
✓ Своя вольная гильдия без требований в World of Warcraft
✓ Полную свободу выбора и действий

В нашем самом свободном сообществе каждый найдёт для себя своё место!

Помните главное:
Вместе мы подобны течению десяти тысяч рек, впадающих в океан. Объединение - вот ключ к успеху.

Today's activity
19
4
0
Server overview
117Total members
5months old
16Age requirement
The Extraction Zone Discord server profile picture
The Extraction Zone
communitygamingextraction gamessocialroleplayfunhangoutchat
Description

🎯 THE EXTRACTION ZONE — The Ultimate Extraction Shooter Discord Looking for teammates for Tarkov, ARC Raiders, DMZ, Marauders, Hunt: Showdown, Delta Force, and more? This is the community built for extraction-shooter players. 🔥 What We Offer: 🎮 Fast LFG matchmaking 🎤 Organized squad voice channels 📹 Raid clips, highlights & funny fails 🔧 Loadout discussions, strategies & game tips 🏆 Active, chill, non-toxic community Whether you're a solo grinder, tactical sweat, casual looter, or hardcore PvP player — you'll find squads, comms, and teammates here. Join The Extraction Zone and squad up.

Today's activity
7
3
4
Server overview
24Total members
2months old
13Age requirement
The Starry Justice Show! (Arc 2) Discord server profile picture
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
486
27
0
Server overview
274Total members
2years old
13Age requirement
/saucee | ask2dm • egirls • dating • social • active Discord server profile picture
/saucee | ask2dm • egirls • dating • social • active
communitysocialchillroleplaygamesanimefriendsactivemoviesdatingegirlactive-voicechatedatingfreakyvc
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
354
21
0
Server overview
1.8kTotal members
1years old
18Age requirement
Girls Frontline: Mercenaries Discord server profile picture
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
251
9
0
Server overview
200Total members
3years old
13Age requirement
𝗗𝟰 Discord server profile picture
𝗗𝟰
communitysocialchillgamingroleplaygameshangoutanimefriendsfunfriendlyartchatmusicactiverobloxvcsfwminecraftlgbtq+memesmangarpeventspoliticsvaloranthorrorenglishnon-toxicprogramminganime rpaireading13+egirlslgbtqcatslgbtq friendlyteenactive-communitysportstechnologyfootballvoice chatnontoxicgamersbooksmusic producersegirlbookclubcutegtaadultsvoice-chatemojiartsmusicianteensgoofyweedactive-voicechatsmoking420gamerapexteen-friendlyhouse of the dragonanime rpgvcsemojisfun factsgame nightsvaporwavetechnicallgbtq+ friendlygame-devraidsno toxicitygta vdevelopershang outpersonal developmentmusic botsemoclassical musiceboystomb-raidersoccerstorytechlgbt friendlysocial community vc fun friendlyraidingskateboardinggamer-girlsweebnukevapingeboyd4gamer-girlskatingscooteractive voice chatraiderssk8stonervaporprogrammersskatergamergirlpartnershippartnershipspartnerpvppcskateskateboardskawritingmoviemovie nightmoviesmovie nightsfilm
Description

𝗗𝟰 𝗶𝘀 𝘁𝗮𝗶𝗹𝗼𝗿𝗲𝗱 𝘁𝗼 𝗮𝗹𝗹 𝗽𝗲𝗼𝗽𝗹𝗲 𝘄𝗵𝗼 𝗷𝗼𝗶𝗻.
● sғᴡ → ᴀʀᴛ
● ᴛᴇᴄʜ → ᴀɴɪᴍᴇ
● ᴍᴜsɪᴄ → ᴍᴇᴍᴇs
● ᴇᴠᴇɴᴛs → sᴏᴄɪᴀʟ
● ᴀᴄᴛɪᴠᴇ → ᴠᴀᴘᴇʀs
● ᴇ-ʙᴏʏs → ʜɪᴘᴘɪᴇs
● ɢᴀᴍɪɴɢ → ᴇ-ɢɪʀʟs
● sᴋᴀᴛᴇʀs → sᴛᴏɴᴇʀs
● ᴇǫᴜᴀʟɪᴛʏ → ᴀᴛʜʟᴇᴛᴇs
● ᴍᴜsɪᴄɪᴀɴs → sᴛʀᴇᴀᴍɪɴɢ
● ʀᴀᴘ-ʙᴀᴛᴛʟᴇs→ ɴᴏɴ-sᴛᴏɴᴇʀs
● ᴘʀᴏɢʀᴀᴍᴍɪɴɢ → ᴄʏʙᴇʀ-sᴇᴄᴜʀɪᴛʏ
● ᴄᴀᴛᴄʜɪɴɢ-ᴘᴇᴅᴏs → ғʀᴇᴇ-ᴇxᴘʀᴇssɪᴏɴ
● ᴀɴᴛɪ-ᴄᴏʀʀᴜᴘᴛɪᴏɴ → ᴍᴜsɪᴄ-ᴘʀᴏᴅᴜᴄᴇʀs
● ᴄᴏɴᴛᴇɴᴛ -ᴄʀᴇᴀᴛᴏʀs → ᴘᴏᴇᴛʀʏ ᴀɴ ǫᴜᴏᴛᴇs
𝗧𝗵𝗲 𝗽𝗲𝗿𝗳𝗲𝗰𝘁 𝗽𝗹𝗮𝗰𝗲 𝗳𝗼𝗿 𝗺𝗲𝗲𝘁𝗶𝗻𝗴 𝗻𝗲𝘄 𝗽𝗲𝗼𝗽𝗹𝗲 𝗲𝘃𝗲𝗿𝘆𝗱𝗮𝘆.

NON-TOXIC

Today's activity
225
30
12
Server overview
761Total members
1years old
13Age requirement
Puella Magi: Maeror Magica Discord server profile picture
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
189
7
0
Server overview
166Total members
4years old
15Age requirement
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
142
20
0
Server overview
1.1kTotal members
5years old
15Age requirement
KRAKENS REACH - BERMUDAS DEPTHS Discord server profile picture
KRAKENS REACH - BERMUDAS DEPTHS
communitysocialchillgaminghangoutwritingrpeventsoclorecasual
Description

The central hub for the beloved Bermudas Depths community, and the house of the Krakenborn. Sip a few beers and praise the Kraken!
A developing storyline set in an alternate dimension of the Bermuda Triangle, where demons prey on unsuspecting lost souls... Participate in contests to develop the setting, enjoy reading lore and asking questions about it, play in gamenights, roleplay, or simply exist. We don't mind whichever path you choose.

Today's activity
178
8
0
Server overview
18Total members
7months old
13Age requirement
Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang Discord server profile picture
Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang
communitysocialchillgamingroleplaygameshangoutfriendsfunfriendlychatmusicactiveminecraftrobloxrpfortnitegiveawaysprogrammingvalorantenglishchattingyoutubenitrolanguagediscordlearningminecraft-servergiveawayminecraft-javaespañolpcpokemongaming-communitywelcomingsupportvoice chatserveractive-communitytradingrobuxcryptospanishfrencheuropepvpnewsgamerspromotradehacksamericacryptosignalsbitcoindaytraderkemeticgermangermanymetin2yangbuym2tradecentermetin2tradermetin2pvpmetin2wonbuymetin2yangbuysmetin2yangbuygermaniametin2yangbuyiberiametin2metin2tradecenterm2trademetin2yangbuyeuropemetin2yangbuyitaliamt2trademetin2tradeusdtmetin2yangmetin2germaniawonbuymetin2teutoniawonbuymetin2teutoniayangbuymetin2teutoniayangkaufenmetin2teutoniawonkaufenmetin2 europe yang buymetin2 europe yangmetin2 italia yang buymetin2 iberia yang buymetin2 tigerghotmetin2 tigerghost yang buymetin2 tigerghost won buymetin2 tigerghost yang kaufenmetin2 tigerghost won kaufenanimemetin2 romania yang buymetin2 romania won buymetin2 ruby kirin won buymetin2 ruby kirin yang buymetin2tr yang satinalmetin2tr won satinalmetin2tr yangmetin2pvp yang satinalmetin2pvp yang buymetin2pvp won buy
user profile pic
metin2.yang13-05-2026 00:53

hi

user profile pic
guardwon13-05-2026 00:56

Metin2 TradeCenter 👽MarketPlace / Metin2Yang/Won All Servers Trader #Metin2Trade #Metin2 metin2yang! Metin2 Global/Official Won/YANG FAST DELIVERY Safe Trade Discord Add : metin2yang 👽-;----FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #Metin2 won buy #Metin2 won farming #buy Metin2 won #Metin2 won guide #how to buy won #Metin2 won tips #Metin2 won making #Metin2 won selling #cheap Metin2 won #Metin2 won tutorial #Metin2 won scams #Metin2 won market #Metin2 won tricks #Metin2 won 2025 #Metin2 won s

Description

Metin2TradeCenter Group 2027 Won/YANG FAST DELIVERY Safe TradeDiscord Add : metin2yang 👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #wonbuy #wonsell #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #metin2yangbuy #dragoncoins #Metin2yangkaufen #sell #metin2tradecenter #buy #tradecenter Metin2 Global/Official Won/YANG FAST DELIVERY Safe TradeDiscord Add : metin2yang👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #Metin2 won buy #Metin2 won farming #buy Metin2 won #Metin2 won guide #how to buy won #Metin2 won tips #Metin2 won making #Metin2 won selling #cheap Metin2 won #Metin2 won tutorial #Metin2 won scams #Metin2 won market #Metin2 won tricks #Metin2 won 2025 #Metin2 won strategies #Metin2 won farming guide #Metin2 won leveling #best Metin2 won #Metin2 won offline shop #Metin2 won alchemy #RubyChimera #RubyKirin #Azrael #Tigerghost #Metin2pvp #Metin2pvm #Metin2p #Metin2.de #Metin2.ro #Metin2.en #Metin2it #Metin2.ru #Metin2.us #Metin2.uk #Metin2.pl #Metin2.cz #Metin2.hu #Metin2.ar #Metin2.ae #Metin2.ea #Metin2.es #Metin2.pt #Metin2.gb #Metin2.ar #Metin2.co #Metin2.co #Metin2.mc #Metin2.mx #Metin2.pe #Metin2.fr #Metin2.magyar #Metin2.br #Metin2.tr #Metin2tr #Metin2.germania #Metin2Teutonia #Metin2Europe #Metin2.eu #Metin2Marmara #Metin2.west #metin2west #Metin2Dandanakan #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell Metin2 Private-gameforge-official Won-YANG discord : metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #metin2tradecenter #tradecenter

Discord Add : metin2yang👽<FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #gameforge #dragoncoin #dragoncoins #wonbuy #wonselll #wonkuanfen #tigerghostwon #tigerghostwonbuy #tigerghostwonsell #tigerghostwonkaufen #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy Metin2Tradecenter Private-gameforge-official Won-YANG discord: metin2yang 👽 <FAST DEL!VERY #Metin2 #Metin2Won #Metin2WonSell #Metin2WonBuy #dragoncoin #metin2tradecenter #tradecenter #wonkuanfen #tigerghost #tigerghostwonbuy #mt2tradecenter #metin2

Today's activity
180
77
0
Server overview
2.0kTotal members
5months old
18Age requirement
The Lords Of Geek 🔞 Discord server profile picture
The Lords Of Geek 🔞
socialcommunitychillgaminghangoutanimefriendsfunartvcmusicactivememesmangamoviesevents18+marvelmultifandomstreamingfriendshipxboxbookstechnologyfandomdcsci-fiplaystationstar warsadult onlyentertainmentcomicsroleplayingnintendopc gamingcontent creatorpodcastsspider-manconsole gamingdiscussionsadultgamerstelevisiontv showspop culturenerd culturetabletop gaminggeek cultureenglish
user profile pic
renegadeoperative07-06-2026 22:03

⚡ Nerds rule the world. Gaming • Anime • Comics • Movies • Podcasts • Events • Community Chaos | Join Lords of Geek today.

Description

The Infinite Ammo Syndicate - Lords Of Geek is a community Discord which covers everything within variety nerd culture. We discuss gaming, anime, comics, movies, and everything in between. You know what they say? Nerds rule the world.

☞︎𝐖𝐡𝐚𝐭 𝐰𝐞 𝐨𝐟𝐟𝐞𝐫☜︎
--------------------------------------------------------------------
🧧▸ An 18+ geek community for fans of gaming, anime, comics, and pop culture.
🧧▸ A gaming hub for co-op, multiplayer, party games, and finding other players.
🧧▸ Active chats, voice chats, and daily conversations across geek culture.
🧧▸ Anime, movie, television, and watch party discussions.
🧧▸ A multifandom hub covering gaming, anime, comics, sci-fi, fantasy, and pop culture.
🧧▸ A place to share fan art, cosplay, writing, and other fandom creations.
🧧▸ Events, podcasts, community spotlights, and other geek-centric activities.
🧧▸ Memes, banter, fun, and the occasional controlled dose of community chaos.

Today's activity
3.6k
43
13
Server overview
378Total members
10years old
18Age requirement
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥 Discord server profile picture
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥
dungeons and dragonsd&dttrpghobbiesdndtabletoproleplay
Description

The City of Brass is a place for people to share and discuss their hobbies, favorite media, and worldbuilding projects; whether it be for a tabletop game like Dungeons and Dragons, or just for the fun of it! We also like to make and give/receive feedback on Hombrew content for D&D!

Today's activity
100
5
0
Server overview
64Total members
4years old
18Age requirement
Monarch's Domain Discord server profile picture
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
2.3k
37
16
Server overview
1.1kTotal members
3years old
13Age requirement
DO UNTO OTHERS. ♰ Discord server profile picture
DO UNTO OTHERS. ♰
roleplayfantasyocswerewolvesvampirescult
Description


Are you tired of feeling lonely, lost, and afraid? Ready to give up and place your life in the hands of hunters who seek to snuff out your life force?

Well, feel afraid no more, dearest lamb, you’ve picked up the right brochure. Here at Sacred Heart Chapel & Monastery, we pride ourselves on building a family for those who have lost their way. Not only are we a place of worship, but we're also a place of love, ready to accept anyone in need. No matter their sins, everyone deserves a safe place.

✞✞✞✞

DO UNTO OTHERS is a Discord roleplay server taking place in 1990, just outside of Montreal, Canada, in the suburban, HOA-run Greenbridge Township, famously known for its extreme normalcy. During the day, townsfolk wander the streets, participating in various activities such as grocery shopping, morning jogs, barbecues, and house painting, completely oblivious to the creatures lurking in the woods around them. At night, however, the quiet church in the center of the town bustles with the supernatural, hailing praise to their cult leader and god, Father Cleopatra Sinclair.

Will you join the cult, pursue a normal life, or maybe join the forces trying to tear down the walls of the church? The choice is yours, so choose carefully.

We offer various things such as:
✞ An immersive roleplay world for you to explore with live events, world news, etc.
✞ Detailed different species for you to play as.
✞ A Friendly, inclusive, lgbtq+ space. That DOESN'T promote censorship.
✞ 17+ members
✞ Staff who are always available to help with anything you need.

.... And Much more!
So, join us today, and invite your friends! We'd love to have you!

xoxo,
DO UNTO OTHERS staff team ✞

Today's activity
74
7
0
Server overview
57Total members
6months old
17Age requirement
Avalon Community | Dedicated Servers & Real Players Discord server profile picture
Avalon Community | Dedicated Servers & Real Players
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
15
6
0
Server overview
1.0kTotal members
8years old
13Age requirement
Mega Man X: Maverick Discord server profile picture
Mega Man X: Maverick
mega manmegamanmega man xmegaman xroleplay
Description

Sirens in the Distance is a 20+ roleplay server, set in the Mega Man X timeline. We are a living and evolving alternate universe, giving players opportunities to introduce their own stories and expand on the MMX lore. We offer a mature, sandbox-style setting, with multiple open-ended plots, allowing players to meaningfully change the course of the Maverick Wars. We are new player-friendly! Prior knowledge of the MMX setting is not required. Canons, OCs and fangame characters are welcome! So come check us out!

Today's activity
56
6
0
Server overview
40Total members
2years old
18Age requirement
Cubolands Discord server profile picture
Cubolands
communitysocialchillgamingroleplaygameshangoutfriendsfunvcrobloxactivesfwminecraftprogrammingpcugcwebsiteminigamesplatformfamilyfriendlyusergeneratedsandbox
Description

We're building a UGC gaming platform where game developers actually get players and players find planets (our term for games) actually worth playing.
While we're still in development, we post sneak peeks daily and actively let you shape the platform.

If you're interested, please do join, as we are opening early access testing soon.

Today's activity
35
6
0
Server overview
44Total members
5months old
13Age requirement
Description

*A girl moves house with her mother and discovers that it was her childhood home where her sister went missing. The forest next to the house draws her in and she wakes up there every night at 1am ever since she first explored. She meets a bunch of people from all different points in time who are also stuck in the forest. They have to fight off all kinds of monsters together and have a few laughs on the way before tragedy.*

Today's activity
9
3
0
Server overview
122Total members
2years old
13Age requirement
Description

***TOKYO GHOUL - TRIBUTES***

*This server is 16+!*
It is modern day Tokyo. Years have passed since the Dragon War. Faux allyships between Ghoul and Mankind have crumbled like castles under poor leadership and glorified silver linings. From the ashes rose tired, angry, and vengeful ghouls that were given fragile promises and hope at living a normal life.

The United Front and newly-instated CCG, lead by Matsuri Washuu, are now at war. The CCG believes that it is their rightful title as Japan's proper justice division and that all ghouls must be executed as a means to prevent a third-wave’s occurrence as well as another Dragon Incident. The wards have been distorted in chaos underneath the surface, as constant warring over Tokyo's wards appears to be never-ending.

The strange world just got stranger. The dead are mysteriously rising, old organizations are returning with new faces and new leadership, and the ghoul and human worlds as we know it are headed for significant changes.

Here there is a very lax ranking system, meaning that, until the free-spots are filled for higher ranking ghouls / investigators you may have to have your character be higher ranked. For those that miss out, do not fret. We are solely-activity based, meaning the longer / more active you are the higher the rank you can become via the Arcane bot level system **in roleplay channels only**. Both canons and original characters are welcome. Create your own paths - your lore is incorporated into the server's lore. Have fun and enjoy your stay!

*What we offer*

- Unlimited OCs
- A complete, unique server with all 24 wards and location channels within them
- Semi-lit - Adv. Lit RP
- A small but growing community of friendly, creative people
- Canon Character roles
- Gartic, music bots and streaming voice chats

Today's activity
20
3
0
Server overview
75Total members
2years old
16Age requirement
Description

✉️ SEND OR RECEIVE DM REQUESTS! ✉️ Step into a welcoming community where every member can shape their own identity. 🎭 With 150+ self-assignable roles, you can showcase your hobbies, interests, personality, and more.

Discord Dating Server, Dating Discord Server, 18+ Discord Server, Discord Dating Community, Online Dating Discord, Discord Love Server, Discord Singles Server, Dating Server Discord, Discord Chat Dating, Discord Relationship Server, join dating discord server, best discord dating servers, active dating discord server 18+, safe dating discord community, meet singles on discord, discord server for dating and relationships, discord matchmaking server, discord flirt server 18+, find partners discord server, real-time chat dating discord, best 18+ dating discord servers to join, active discord dating servers for adults, how to find dating servers on discord, discord servers for singles and relationships, safe discord dating communities 18 and up, discord server to meet new people romantically, discord dating chat rooms 18+ active users, join discord server to meet singles online, best places to meet people on discord for dating, dating and friendship discord server 18 plus, discord social server, discord friendship and dating, online community for singles, meet people online discord, casual dating discord server, serious dating discord community, voice chat dating discord, text chat dating server, gaming and dating discord server, international dating discord server, adult discord dating chat, discord meetup server, social discord for adults, flirt and chat discord server, relationship building discord server, singles chat 18+ discord, make friends and date discord server

Today's activity
18.1k
1.0k
65
Server overview
9.5kTotal members
4years old
18Age requirement
Equestria Girls: Crossing Worlds Discord server profile picture
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
782
27
6
Server overview
160Total members
1years old
16Age requirement
The Writer's Library {{21+ RP Hub}} Discord server profile picture
The Writer's Library {{21+ RP Hub}}
friendlysocialroleplayrpcommunitywritingroleplayerroleplay partnerwritersactive
Description

Welcome to the Writers Library. All writing levels are welcome! We are a 21+ Role Play server. We do request your work be human written. Here you can find yourself lost in the pages of your own creations and meet other writers to join you.

Today's activity
4.7k
71
4
Server overview
365Total members
10months old
21Age requirement
Rus' | Into The Frost Discord server profile picture
Rus' | Into The Frost
adventurefantasymedievalroleplay
Description

With a long winter preparing to encapsulate the Tsardom of Rus' and all living things within the Russkaya Zemlya, we invite you to join us in the new and improved Rus' Universe. Dobro pozhalovat' v Rus! Welcome to the Rus', my friend. The "Rus' | Into The Frost" is a server based on 15th-Century Medieval Russia with a fantasy twist. Imagine a world where legendary creatures found in traditional folklore coexisted alongside ManKind. It is in our universe that adventurers from all corners of the globe travel to the Land of the Rus' to test their mettle against the ferocious beasts that dominate the cold lands. Limited by only your own brilliant creativity, you are allowed to start off as a majestic and nimble Kitsune from the Far East—using magic to turn your foes to dust. You can even try to slay beasts as an Elven Archer from the Germanic Region who can strike down their prey from miles away, a werewolf, vampire, orc, and so much more. Don't be afraid to strive for whatever your artistic mind desires. This is a community that accepts all passionate to write, role-play, and help build an immersive universe influenced by its members and everything we do as a community. Upon joining, we ask that you take the time to read the instructions provided in our welcome channel. We are a very well-written and fleshed-out server. We hope that you'll be joining us very soon on our courageous adventures, friend.

Today's activity
85
7
0
Server overview
42Total members
3years old
18Age requirement
Description

𝐒𝐄𝐕𝐄𝐍.. 𝐒𝐈𝐗... 𝐄𝐋𝐄𝐕𝐄𝐍... 𝐅𝐈𝐕𝐄... 𝐍𝐈𝐍𝐄 𝐀𝐍' 𝐓𝐖𝐄𝐍𝐓𝐘 𝐌𝐈𝐋𝐄 𝐓𝐎-𝐃𝐀𝐘... 𝐅𝐎𝐔𝐑... 𝐄𝐋𝐄𝐕𝐄𝐍.. 𝐒𝐄𝐕𝐄𝐍𝐓𝐄𝐄𝐍.. 𝐓𝐇𝐈𝐑𝐓𝐘-𝐓𝐖𝐎 𝐓𝐇𝐄 𝐃𝐀𝐘 𝐁𝐄𝐅𝐎𝐑𝐄..

⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆
est. 7th November 2023. The most long lasting, active vibey aot rp server you'll ever find. **SERVER TAG + EXCLUSIVE ROLES!!** ( and 24/7 poketwo)

Interested in joining a chill out aot rp server on disc thats also active, with amazing and hilarious (and actual NON toxic) members? This server supports all styles of RPing. Here's why you should join:
╰┈➤There are SO many available canon characters to choose from, (and by choosing a canon, you're also guaranteed a unique role, [yes- even the "minor side characters"] no service required!) and we LOVE OCs!! There are many activities that take place including royal balls/galas, battles, path sequences and so much more.. and even an actor au! ╰┈➤The server allows you to focus on your character as well as their interactions with others. NO ONE is ever left out in the plot.
╰┈➤Choose where your character comes from (if an OC) I.E Marleyan or Eldian. There are loads and loads of different channels, (including Marley, beyond the walls, and more!) This server also doesn't have an over-the-top combat system or rules, you can go crazy! (just not OP.)
╰┈➤The plot has a perfect balance of comedy, combat, romance, serious RP and many tear jerking moments.
╰┈➤ This server is perfect for any RPer who is just starting out, getting back into the fandom, or just wants a chance to show off some writing. But wait, there's more!
╰┈➤ We don't just do RP here. We have regular silly VC's, music nights, game streams, UNO, and many more! With that said, thank you so much and I know we'll all be able to give eachother a memorable RP experience!
⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆

𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒... 𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒.. 𝐌𝐎𝐕𝐈𝐍' 𝐔𝐏 𝐀𝐍' 𝐃𝐎𝐖𝐍 𝐀𝐆𝐀𝐈𝐍.. 𝐓𝐇𝐄𝐑𝐄'𝐒 𝐍𝐎 𝐃𝐈𝐒𝐂𝐇𝐀𝐑𝐆𝐄 𝐈𝐍 𝐓𝐇𝐄 𝗪𝐀𝐑.

Today's activity
10.5k
55
10
Server overview
628Total members
2years old
13Age requirement
Furry Valley Discord server profile picture
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
1.4k
39
5
Server overview
12.4kTotal members
9years old
13Age requirement
Clan NZ Senkais™ Discord server profile picture
Clan NZ Senkais™
socialcommunitygamingrobloxchatmemesmusicespañolspanishjailbreakbloxfruitmeepcityadopt meamistadgamesjuegojuegosyoutubeamigoamigosanimelatinobattlegroundsgrupogrupo de robloxalianzachillcomunidadtwitchvideojuegosroleplayrpmusicamusicvcgamesfun
Joininactive
Description

SERVIDOR OFICIAL Bienvenidos A Clan NZ Senkais™ ツ ★┆NO HAY REGLAS Espero Les Guste Cracks ;3

Today's activity
29
2
0
Server overview
78Total members
2years old
13Age requirement
Sex World Discord server profile picture
Sex World
roleplayanimemangarpjjkanime rpanime roleplayjujutsu kaisenjjk rpmanga rpjujutsu kaisen roleplayanime mangajjk roleplayjujutsu kaisen rp
Joininactive
Description

𝐽𝑈𝐽𝑈𝑇𝑆𝑈 𝑆𝑂𝑈𝑆𝐸𝑁 — 𝑅𝐸𝑉𝐸𝐿𝐴𝑇𝐼𝑂𝑁𝑆
⇢ 𝗟𝗢𝗢𝗞𝗜𝗡𝗚 𝗙𝗢𝗥 𝗛𝗘𝗜𝗔𝗡 𝗘𝗥𝗔 𝗝𝗝𝗞 𝗥𝗣?

⇢ Wanna host missions? Wanna make it to the top? And with no stat system, no starting off at the weakest you could possibly be, and both the ability to grow IRP, as well as not having to worry about overbearing restrictions that mess up your character's narrative, while doing so? Well, you're at the right place! Now, on to the actual ad...

⇢ Time comes for us all, no doubt, but death 𝘥𝘰𝘦𝘴 wait.

⇢ The world of jujutsu will never be the same again, not after 𝙩𝙝𝙞𝙨... because 𝙚𝙫𝙚𝙧𝙮𝙩𝙝𝙞𝙣𝙜 is on the brink of changing forever. The turn of the first millenium draws near, and... so much has been lost. The age old war between man and curse has reached its peak, unspeakable evils have been unleashed, and no man, woman or child in Japan has been spared from the consequences. This is the height of the Heian era, what will you do?

Today's activity
14
2
0
Server overview
61Total members
10months old
13Age requirement
[ARCHIVED] Emesia Nation RP Season 4 Discord server profile picture
[ARCHIVED] Emesia Nation RP Season 4
nationsroleplayeconomyseasonslgbtq inclusivesupportive staff
Joininactive
Description

Emesia nrp Is a fictional nrp based in 1941 as of season 2 its a fun rp server with supportive staff and its lgbtq inclusive and the owner is transgender so enjoy making a nation or company in Emesia!

Today's activity
10
1
0
Server overview
27Total members
2years old
13Age requirement
Description

A Hunger Games roleplay!

Today's activity
4
3
0
Server overview
101Total members
4years old
16Age requirement
R&Dé Discord server profile picture
R&Dé
communityroleplayboard gamesfrance
user profile pic
.tzen17-09-2024 17:22

Bonsoir à tous !

user profile pic
.tzen18-09-2024 09:27

Le Monopoly c'est super (non)

user profile pic
.tzen15-10-2025 10:28

Bienvenue à tous les créateurs et passionnés de jeux de société !

user profile pic
.tzen15-10-2025 18:55

Yoyoyo

user profile pic
.tzen16-10-2025 18:55

Jeux de soc.

user profile pic
.tzen17-10-2025 10:02

Bienvenue !

user profile pic
.tzen20-10-2025 18:20

Welcome all!

user profile pic
.tzen21-10-2025 14:10

Bienvenue à toutes et tous :)

user profile pic
.tzen21-10-2025 21:35

Bienvenue à toutes et tous :)

user profile pic
.tzen22-10-2025 10:11

yoyoyo

user profile pic
.tzen22-10-2025 21:17

oyo

user profile pic
.tzen23-10-2025 17:34

Yoyo

user profile pic
.tzen24-10-2025 15:12

YOyoyo

user profile pic
.tzen25-10-2025 11:51

yoyo

user profile pic
.tzen26-10-2025 11:18

yoyoyo

user profile pic
.tzen27-10-2025 18:38

Yoyo

user profile pic
.tzen29-10-2025 16:58

yoyoyoyo

user profile pic
.tzen31-10-2025 13:43

Yoyoyo

user profile pic
.tzen01-11-2025 13:32

Eyo

user profile pic
.tzen02-11-2025 13:16

yoyoyo

user profile pic
.tzen04-11-2025 12:02

Bonsoir

user profile pic
.tzen10-11-2025 12:48

yoyo

user profile pic
.tzen11-11-2025 12:23

yo

user profile pic
.tzen12-11-2025 13:01

Bienvenue !

user profile pic
.tzen12-11-2025 20:44

Yoyo

user profile pic
.tzen13-11-2025 16:37

yoyo

user profile pic
.tzen13-11-2025 21:15

Bonsoir.

user profile pic
.tzen17-11-2025 19:59

Yo!

user profile pic
.tzen19-11-2025 11:42

yoyo

user profile pic
.tzen21-11-2025 14:46

|

user profile pic
.tzen25-11-2025 18:03

Yoyo

user profile pic
.tzen26-11-2025 13:54

Yoy

user profile pic
.tzen27-11-2025 19:10

Bonsoir!

user profile pic
.tzen28-11-2025 14:05

Yoyoyo

user profile pic
.tzen01-12-2025 21:59

Yoyo

user profile pic
.tzen02-12-2025 12:40

YOyo

user profile pic
.tzen02-12-2025 17:28

Yoyoyo

user profile pic
.tzen03-12-2025 12:57

Yoyo

user profile pic
.tzen05-12-2025 15:08

Yoyo

user profile pic
.tzen05-12-2025 22:01

Yoyoyo

user profile pic
.tzen14-12-2025 18:24

Upupp

user profile pic
.tzen17-12-2025 14:32

Yoyo

user profile pic
.tzen19-12-2025 21:04

Yoyo

user profile pic
.tzen23-12-2025 12:39

yo

user profile pic
.tzen24-12-2025 15:33

yoyo

user profile pic
.tzen26-12-2025 16:11

yoyo

user profile pic
.tzen27-12-2025 14:32

Bienvenue !

user profile pic
.tzen06-01-2026 11:06

yoYO

user profile pic
.tzen08-02-2026 17:58

Bonsoir!

user profile pic
.tzen05-05-2026 11:37

:)

user profile pic
.tzen06-05-2026 13:58

Yoyo

user profile pic
.tzen18-05-2026 22:22

oy!

user profile pic
.tzen21-05-2026 14:50

Bonsoir!

user profile pic
.tzen16-06-2026 13:13

Yoyoyoyoy

user profile pic
.tzen17-07-2026 09:30

YOyoyo

Description

🎲 Bienvenue sur R&Dé ! C'est LA communauté qui rapproche joueurs passionnés et créateurs chevronnés. Rejoignez des conversations animées sur les derniers jeux, découvrez des stratégies, échangez des astuces et trouvez des partenaires pour des parties endiablées. Nous organisons régulièrement des soirées de jeu, de création, des tournois et des événements spéciaux comme des game jams. Entrez dans la famille ludique R&Dé ! Tous : • partagez vos coups de cœurs • découvrez des nouveautés • trouvez des compagnons de jeu • jouez ensemble • partagez des stratégies • accès exclusif à des prototypes originaux Créateurs : • bénéficiez du retour des joueurs • demandez des conseils • partagez vos expériences Ensemble, inventons les classiques de demain ! Suivez-nous sur les réseaux et partagez à vos amis joueurs : • Twitch https://www.twitch.tv/rdegames • X TBD • Facebook TBD • Youtube TBD • Discord https://discord.gg/CFutHdqjRh

Today's activity
3
2
0
Server overview
236Total members
1years old
13Age requirement
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★ Discord server profile picture
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★
roleplaysocialcommunitychillanimehangoutcreativemangaliterateocbleachbleach rpbleach roleplayanime rpanime roleplaymanga rp
user profile pic
coolin.real15-11-2024 18:14

hi guys!

Description

[**``黒— ★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★``**] ***Join our server for an interesting run, an adventure throughout multiple different worlds and realms, a deeper perspective on several different races and untold stories in this entirely new world. You may fight strong opponents, take on new heights, push yourself beyond your limits and even face off against those above! With or without a purpose, be a an active participant in the lore of our server that revolves entirely on you all. Destroy the strongest hollows or even reapers, quincies, fullbringers, humans (hell anything you name it) this era has ever known or just simply do your own thing; Awaken a bankai, shoot arrows, become an espada or develop a mask! The opportunities are practically endless in this Mugetsu world! With several systems to guide your very actions and several people willing to rp with you where could things go wrong? immerse yourself in our very own Bleach universe, and interact with fellow fans. With engaging roleplay, thrilling storylines, and a welcoming community, this server is the ultimate destination for fans of all ages. Don't miss out on the chance to explore the vast world of Bleach and create unforgettable memories with like-minded enthusiasts. Join now and let’s start up this journey today, Karakura town is awaiting you!*** **Our own unique take on Bleach, you took the time to read this far so we KNOW you’re interested!** **``We offer: A forum based oc submission system where we can easily interact with you and point out certain details Several different templates for multiple different things such as weaponry, zanpakuto, and the different races showcased in the anime/manga! An active staff team The chance to influence the story or have your own arcs Be part of the main cast! Everyone is really, I mean it! A multitude of different systems for important techniques and skills such as the transformations (such as bankai, shikai, training, resurrecion and mastery) A lot of channels that give background information on what you can do with the bleach power systems so even if you haven’t actually seen the series or read the manga you could read up for a basic understanding! The chance to utilise cool transformations, zanpakuto's, kido spells, or even create your own Influence a moving plot a money system a moving story and a chance to give your own two cents``** ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Links: https://discord.gg/uKK8Q3nggG [let's go, your journey starts now!](https://tenor.com/bQ7nQ.gif) Pings: ||@everyone @here||

Today's activity
2
2
0
Server overview
461Total members
1years old
13Age requirement
Japan - PolSim Discord server profile picture
Japan - PolSim
japanpoliticsroleplay
user profile pic
machtige.leeuw03-09-2024 18:44

Join Japan

Description

Political Simulator about Japan. Join today to expierce a good and exiting server!

Today's activity
2
1
0
Server overview
37Total members
2years old
13Age requirement
✧ 𝙰𝚖𝚊𝚛𝚢𝚜: 𝙵𝚊𝚕𝚕𝚎𝚗 𝚂𝚔𝚒𝚎𝚜 ✧ Discord server profile picture
✧ 𝙰𝚖𝚊𝚛𝚢𝚜: 𝙵𝚊𝚕𝚕𝚎𝚗 𝚂𝚔𝚒𝚎𝚜 ✧
apocalyptic roleplaycommunityfantasy roleplayfantasy rproleplay
Joininactive
Description

✨ 𝐀𝐦𝐚𝐫𝐲𝐬 - 𝐅𝐚𝐥𝐥𝐞𝐧 𝐒𝐤𝐢𝐞𝐬

`WE ARE ALL SURVIVORS.`

`WITH OUR RESILIENCE, WE FORGE THROUGH THIS BROKEN WORLD`

•• ━━━━━ ••●•• ━━━━━ ••

```THE ARCHIVES ```

*A thousand years ago, the world was at war, the Catalyst Comet was looming over the skies. A harbinger of change. There was no hope.

Only **Three Impacts.**

The Catalyst Comet crashed, the Tsar Bomba was detonated, and Eis, the most powerful magical spell known to man shattered upon the world.

In the madness, as all awaited for the dust to settle, the beast that slumbered underneath the world awoke.

Daedalus’s Labyrinth.

And along with it, so did deeply earthed magic and species, reshaping the structure of the world, our world into a new story. The story of Amarys.*

```YEAR: 3011```

This is where you, a **Survivor** come in. The world has matured, grown. Factions were formed, wars were had, but the world is still healing.

Now.. as the next Catalyst Comet approaches the world.. is your time, to forge your way through this broken world. Change the course of history, form bonds and rivalries, and enjoy yourselves to the fullest!

•• ━━━━━ ••●•• ━━━━━ ••

**What we offer:**
- Post Apocalyptic Fantasy RP
- Factions to join, such as the Church of Versailles, the Hidden Suns and more!
- 7 classes to choose from with unique strengths and weaknesses!
- A crafting system to make magical items/technology, and a currency system to trade them and items recovered in raids!
- Catch up with our XP system regardless of when you joined!
- The ability to make pre-integrated characters to fill the world out!
- Freedom to pick your species, occupation and lore!
- Plenty of channels for both rp and ooc!
- Multiple and frequent events to take on for all levels of strength!
- And more!

We hope to see you soon!

Today's activity
2
1
0
Server overview
417Total members
2years old
14Age requirement
Teyvat Roleplay Discord server profile picture
Teyvat Roleplay
genshinroleplayteyvatlgbtq
Joininactive
Description

7th grade to senior high school only, mostly genshin impact roleplaying but also other stuff just socializing

Today's activity
0
0
0
Server overview
8Total members
2months old
13Age requirement
— 𝘿𝙞𝙖𝙗𝙡𝙤’𝙨 𝙗𝙖𝙨𝙚 — Discord server profile picture
— 𝘿𝙞𝙖𝙗𝙡𝙤’𝙨 𝙗𝙖𝙨𝙚 —
socialroleplayhangoutfunfriendlyvcenglishmultifandom
Joininactive
Description

✶ DIABLO'S BASE ✶
・ A brand new one of a kind discord server where We ROLEPLAY call of duty (ROLEPLAY. We sometimes play CoD of course), or hang out in general
We accept everyone such as: Yumeshippers, Roleplayer’s (only military/cod for now, sorry!), multiple fandoms and so much more!
We are.. : open to partnerships, open to new suggestions, and open to anyone alike
we have a VERY ACTIVE admin (second in command / co-owner) and General (owner) . We would LOVE to see you in our server, and we are VERY kind and welcoming!
(please verify)
REMINDER THAT THERE ARE
FICTIONKINS,YUMESHIPPERS AND SYSTEMS HERE!
WE DO NOT ALLOW: P3DOS, Z00S OR DARKSHIPPERS.
We also vc a lot hehe.. Oh and we currently need 2 active staff (moderators)
(our owner and co-owner is very active, feel free to join and interact with us! Thx and maybe consider Joining..?)

Today's activity
0
0
0
Server overview
43Total members
3months old
13Age requirement
DECEIT [RP] Discord server profile picture
DECEIT [RP]
communityroleplayrp
Joininactive
Description

˗ˏˋ ✞ ˎˊ˗ 𝐃𝐄𝐂𝐄𝐈𝐓 ˗ˏˋ ✞ ˎˊ˗ “I will not tell you the visceral details as you already know them, you all do. It's happening to every-body.”
═══════════════
On the eve of the outbreak, Southwood, Alabama's population sat at 8,000. Now? hundreds, a bustling coastal city transformed into nothing more than a shell of it's former glory. It wasn't always this way, yet an inconceivable turn of events left thousands wondering if hope was well and truly lost. You weren't lucky enough to be picked up by the military convoys that left town at the behest of the United States Government, no, you were left behind, discarded, and no matter how unhappy you were about that fact, nothing could change how you were now among Fairhope's last remaining inhabitants. There was no telling just what could happen, the cataclysm of the world as we know it was sure to bring about some major changes. Were you going to embrace it, or desperately cling onto whatever hope humanity had left..?
═══════════════
“No-one you know is a good person.”
═══════════════
What Deceit Offers... {✞}

HORROR + APOCALYPTIC THEMES — Built by a team of previous apocalypse-RPers, Deceit offers a range of apocalyptic themes within it's plotlines, all based in the fictional coastal town of Southwood, Alabama . We don't merely focus on the dark, gritty aspects of the apocalypse, but also the wider picture. We aim to make our world as immersive as possible so that everyone can get the most enjoyment out of roleplaying here.

{✞} CREATIVE SPACE FOR ALL SKILL-LEVELS — With the rise in AI over recent years, we've noticed a severe lack in creative spaces. Deceit offers a creative outlet for writers of all skill-levels, whether you're literate writer who wants to improve their work, or a multi-paragraph writer who wants to tell an immersive story, there's a place for you here. AI is banned entirely.

{✞} INTERACTIVE LORE — We've implemented not only a D20 system, but also certain guidelines for events that mean your choices matter. There are real stakes behind every choice your character makes, meaning every single session carries a unique sort of tension. {✞} MEMBER FEEDBACK — Ultimately, we are not immune to taking criticism. If there are certain aspects of the server that you think could be improved upon, then tell us so we can ensure a positive experience for everyone.
═══════════════

Today's activity
0
0
0
Server overview
39Total members
2years old
13Age requirement
FIM: World in Darkness Discord server profile picture
FIM: World in Darkness
roleplayrpmlpzombieapolcaypsezombie-rp
user profile pic
somemfwholikeshalo11-01-2026 19:03

FIM: World in Darkness can be considered an AU, It takes place in a version of Equestria where the Elements of Harmony failed to conceal Nightmare Moon and only helped her plunge the world into chaos. It is a literate Roleplay server, and I would love to meet new people who would love to build on a story and create something great! I am currently the only admin on the server, but that could possibly change in the future. I am looking for a group of people, at a minimum, who would like to participate in a story. Tired of the usual MLP Roleplay server? Then give this server a try!

Description

FIM: World in Darkness can be considered an AU, It takes place in a version of Equestria where the Elements of Harmony failed to conceal Nightmare Moon and only helped her plunge the world into chaos. It is a literate Roleplay server, and I would love to meet new people who would love to build on a story and create something great! I am currently the only admin on the server, but that could possibly change in the future. I am looking for a group of people, at a minimum, who would like to participate in a story. Tired of the usual MLP Roleplay server? Then give this server a try!

Today's activity
0
0
0
Server overview
6Total members
6months old
18Age requirement
RythmRP | ERLC Discord server profile picture
RythmRP | ERLC
roleplayrobloxerlc
Joininactive
Description

Projekt RythmRP został stworzony w celu wprowadzenia w końcu dobrego serwa na polskim community cały zespoł stara się go prowadzić jak najlepiej jak może mamy wiele zaawansowanych funkcji a nasi administratorzy są jednymi z najlepszych! Dzięki doświadczeniu Project Leaderów liczymy że serwer wypali!

Today's activity
0
0
0
Server overview
27Total members
7months old
13Age requirement
What should have never been. . . (18+ CRK RP) Discord server profile picture
What should have never been. . . (18+ CRK RP)
roleplaycookie runcookie run rpcookie run kingdom
Joininactive
Description

Years have passed since the world was torn apart. The Ancient Heroes have returned but so did Dark Enchantress Cookie with the Beasts at her side. Reclaiming their original soul jams, it seemed as if this should have never happened… But a spark of light shines in the distance. Even when defeated, the Ancient Heroes still fought for what was right. Will you stand with the Ancient Heroes? Or join the Beasts in complete annihilation? Or perhaps… there is yet a third option. Decide the fate of Earthbread today and join us.

ABOUT
. •. ⋆ Cookie Run Kingdom/Ovenbreak AU
°。Literate to Novella RP
°。Lore-Driven Events & Plotlines
°。LGBT+ Friendly
. •. ⋆ 18+, ID Verified Community

Today's activity
0
0
0
Server overview
26Total members
1years old
18Age requirement

202 servers found