Rp Discord servers

215 servers found

server profile pic
city in the sky · fluffy tag | halloween events 🎃
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
9.7k💬
319🟢
110👥
1📞
Server overview
2.4k👥Total members
9📅months old
13+Age requirement
server profile pic
Pine Creek Summer Camp 🏕
roleplayrpslice of lifesolcommunity
Description

We are an 18+ SFW roleplay server that mainly focuses on slice of life but we encourage our members to be as creative as they wish. Whether you want some adventure, angst, mystery or romance, we can do it all here.

We encourage creativity and enjoy a smattering of chaos from time to time - whether it be kids getting revenge against a mean staff member, escalating prank wars or accidentally burning down the boathouse with a misplaced firework.

The Pine Creek Summer Camp is an inclusive camp for children and teenagers from all walks of life - with special catering for those who are disabled, neurodivergent or in any way impoverished or troubled. With fun indoor and outdoor activities, all are welcome.

We have dozens of indoor and outdoor locations for 1x1 and small group roleplays as well as chatroom style channels you can use to talk as your characters to other characters. We use Tupperbox for added immersion and are happy to help beginners set up their characters and learn how to use it.

What we offer:
▫️ A welcoming, friendly community
▫️ Inclusive to everybody, regardless of race, religion, gender or sexuality
▫️ Dedicated staff who are passionate about roleplaying
▫️ OOC chat channels
▫️ Media, meme, and art channels

Today's activity
8.8k💬
21🟢
25👥
0📞
Server overview
52👥Total members
2📅months old
18+Age requirement
server profile pic
𝐉𝐔𝐉𝐔𝐓𝐒𝐔 𝐒𝐎𝐔𝐒𝐄𝐍 — 𝐑𝐄𝐕𝐄𝐋𝐀𝐓𝐈𝐎𝐍𝐒
roleplayanimemangarpjjkanime rpanime roleplayjujutsu kaisenjjk rpmanga rpjujutsu kaisen roleplayanime mangajjk roleplayjujutsu kaisen rp
Description

𝐽𝑈𝐽𝑈𝑇𝑆𝑈 𝑆𝑂𝑈𝑆𝐸𝑁 — 𝑅𝐸𝑉𝐸𝐿𝐴𝑇𝐼𝑂𝑁𝑆
⇢ 𝗟𝗢𝗢𝗞𝗜𝗡𝗚 𝗙𝗢𝗥 𝗛𝗘𝗜𝗔𝗡 𝗘𝗥𝗔 𝗝𝗝𝗞 𝗥𝗣?

⇢ Wanna host missions? Wanna make it to the top? And with no stat system, no starting off at the weakest you could possibly be, and both the ability to grow IRP, as well as not having to worry about overbearing restrictions that mess up your character's narrative, while doing so? Well, you're at the right place! Now, on to the actual ad...

⇢ Time comes for us all, no doubt, but death 𝘥𝘰𝘦𝘴 wait.

⇢ The world of jujutsu will never be the same again, not after 𝙩𝙝𝙞𝙨... because 𝙚𝙫𝙚𝙧𝙮𝙩𝙝𝙞𝙣𝙜 is on the brink of changing forever. The turn of the first millenium draws near, and... so much has been lost. The age old war between man and curse has reached its peak, unspeakable evils have been unleashed, and no man, woman or child in Japan has been spared from the consequences. This is the height of the Heian era, what will you do?

Today's activity
6.1k💬
48🟢
31👥
0📞
Server overview
143👥Total members
1📅months old
13+Age requirement
Description

Little Heartaches, a little nightmares AU

After Six dropped Mono into the signal tower he became a slave to it, the thin man ensures that he can't leave the city. His only hope for escaping is a little girl called Noone, who saw something in the tower, something she wasn't supposed to see.

Six is far away from Pale City, aboard the Maw. She has no memory of Mono as all the pain and suffering Monos "betrayal" caused had made part of herself separate and become Shadow Six, who keeps Six from the truth and tries to distract her. Like bringing her to the Maw so she can find her long lost brother Seven, the runaway kid.

Otto continues his search for his long lost brother and sister (Mono and raincoat girl). He claims he's a specialist in dream psychology, and that he can cure nightmare disorder. Which gives him a steady supply of children

What we offer!
100s of RP channels with pictures pinned

Plot driven RP, this server will have on overarching story which everyone can be a part of, whether they're using ocs or cannons

The Sounds of Nightmares characters are claimable and we are(as far as I know) the first ln server to include them in the lore!

You can RP in and out of the Nowhere, patients and psychiatrists are allowed. Gatekeeper ocs are too!(a gatekeeper is basically like the candleman, taking kids across the threshold bla bla bla)

A welcoming and kind community (even if it's small)

We hope that you join, see you there!

Today's activity
28💬
19🟢
3👥
0📞
Server overview
45👥Total members
1📅years old
13+Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
3.6k💬
99🟢
25👥
0📞
Server overview
631👥Total members
5📅years old
14+Age requirement
server profile pic
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
3.5k💬
36🟢
30👥
8📞
Server overview
119👥Total members
2📅years old
14+Age requirement
server profile pic
A Helluva Fire and Heavens Glow
roleplaylgbtq+literaterpcreativesemi-literatehazbin hotelnovellahelluva bosssemi-lithellhelluvahazbin hotel rphazbinhelluva boss rp
Description

✧ 𝐀 𝐇𝐞𝐥𝐥𝐮𝐯𝐚 𝐅𝐢𝐫𝐞 𝐚𝐧𝐝 𝐇𝐞𝐚𝐯𝐞𝐧’𝐬 𝐆𝐥𝐨𝐰 ✧ Hey there, wayward sinner. Are you a fan of Hazbin Hotel or Helluva Boss? Do you enjoy diving into rich, character-driven roleplay? Then welcome aboard. This is a roleplay server inspired by Vivziepop’s creations—Hazbin Hotel and Helluva Boss—with a focus on detailed storytelling, strong character arcs, and a community that thrives on creativity. ✧. ┊  𝘛𝘩𝘪𝘴 𝘪𝘴 𝘢 𝘭𝘰𝘳𝘦-𝘩𝘦𝘢𝘷𝘺, 𝘭𝘰𝘳𝘦-𝘧𝘰𝘤𝘶𝘴𝘦𝘥 𝘴𝘦𝘳𝘷𝘦𝘳 𝘣𝘶𝘪𝘭𝘵 𝘧𝘰𝘳 𝘴𝘵𝘰𝘳𝘺𝘵𝘦𝘭𝘭𝘦𝘳𝘴. ┊.✧ ✧ 𝗪𝗛𝗔𝗧 𝗬𝗢𝗨 𝗖𝗔𝗡 𝗘𝗫𝗣𝗘𝗖𝗧 ✧ ★ — A variety of channels to explore, both IC and OOC ★ — Fun, multipurpose bots to enhance your RP experience ★ — Required, in-depth character templates to help shape your creations ★ — An active, reliable staff team that’s here for you ★ — Semi-lit to novella styled writers welcome ★ — Simple, clean server layout ★ — 18+ server | ID verification is mandatory ✧ 𝗢𝗩𝗘𝗥𝗩𝗜𝗘𝗪 ✧ This is a roleplay server for Hazbin Hotel and Helluva Boss, built by fans for fans. 𝙒𝙚’𝙧𝙚 𝙖 𝙛𝙖𝙣𝙤𝙣 𝙡𝙤𝙧𝙚-𝙘𝙚𝙣𝙩𝙧𝙞𝙘 𝙘𝙤𝙢𝙢𝙪𝙣𝙞𝙩𝙮, and we take pride in weaving complex stories and character arcs together. Everyone is welcome here—no matter who you are. Our mod team is committed to keeping things safe, inclusive, and drama-free. You can claim up to 2 canon characters and submit as many OCs as your hellish (or heavenly) heart desires. Many major roles are still open, be sure to come in and grab them quick~! We’d love to have you join our circle—come be part of the story. ♡

Today's activity
3.2k💬
26🟢
27👥
8📞
Server overview
47👥Total members
2📅years old
18+Age requirement
server profile pic
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
532💬
61🟢
15👥
0📞
Server overview
199👥Total members
2📅years old
13+Age requirement
server profile pic
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
2.2k💬
57🟢
24👥
13📞
Server overview
1.0k👥Total members
3📅years old
13+Age requirement
server profile pic
Grim Circus
roleplayfunrpocblyaoicircushorrorromance
Description

A yaoi rolepay server loosely inspired by the Dark Woods Circus song
------
A circus rolls into town, the sound of a train on long abandoned tracks, tents set up at the edge of town. The forms of the performers is strange, a deformed beauty with the voice of an angel, the ringmaster with the glowing eyes and pointed teeth hidden behind a charming smile.
As men start to go missing, the circus vanishes just as suddenly as it was set up, the only evidence it was ever there is popcorn and hay scattered and trodden into the grass
At the next town, new faces can be found among the members of the circus and there is fresh meat on the plate of the freakshow's cannibal. At the end of the show odd features can not be removed.
The charming ringmaster has tricks up his sleeves. A witch twisted by solitude and torture, he collects boys and twists them like he was, changing their appearance to his fancy with surgery and magic, taking apart those who do not meet his standards for parts, disposing of what he can't use in the bellies of beasts. His collection is cursed and bound so they can never abandon the circus.
Once you are lured into the circus you can never leave.
Are you ready to join the circus?
------
Please only join if you are 18 or older, We'd like to fully be able to explore the horror themes that could apply to the setting. It is however sfw in the main areas.

Today's activity
13💬
10🟢
3👥
0📞
Server overview
13👥Total members
20📅days old
18+Age requirement
server profile pic
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥
dungeons and dragonsd&dttrpghobbiesdndtabletoproleplay
Description

The City of Brass is a place for people to share and discuss their hobbies, favorite media, and worldbuilding projects; whether it be for a tabletop game like Dungeons and Dragons, or just for the fun of it! We also like to make and give/receive feedback on Hombrew content for D&D!

Today's activity
87💬
33🟢
7👥
0📞
Server overview
77👥Total members
4📅years old
18+Age requirement
server profile pic
𝗗𝟰
communitysocialchillroleplaygaminggamesanimehangoutfriendsfunfriendlyartchatmusicsfwvcrobloxminecraftactivemangamoviesmemeseventsfortniterpvalorantcreativeprogrammingweedgtasmoking420equalityd4amongusstoner
Description

A server designed to fit the interests of every member that joins, while being a safe community.

● 𝐀 𝐂𝐎𝐌𝐌𝐔𝐍𝐈𝐓𝐘 𝐌𝐀𝐃𝐄 𝐅𝐎𝐑
┃ WEEBS
┃ GAMERS
┃ STONERS
┃ SKATERS
┃ ARTISTS
┃ HIPPIES
┃ EQUALITY
┃ ATHLETES
┃ MUSICIANS
┃ PROGRAMMERS
┃ MOVIE NIGHTS
┃ CONTENT CREATORS
┃ FREEDOM OF ┃EXPRESSION
● 𝗛𝗘𝗥𝗘 𝗔𝗧 𝗗𝟰 𝗪𝗘 𝗖𝗔𝗧𝗖𝗛 𝗣𝗘𝗗𝗢𝗦

Today's activity
1.3k💬
87🟢
44👥
14📞
Server overview
351👥Total members
4📅months old
13+Age requirement
server profile pic
Dragon Ball Finality
communityroleplayvoicedbzdbdragon ball
Description

🌌 DRAGON BALL FINALITY 🌌
An 18+ literate, stat-based roleplay server

📜 The Setting
Age 430 — the Earth is raw and untamed.
No capsules, no space travel — only scattered kingdoms, hidden dojos, and wandering martial artists. Ki is rare, magic is feared, and demons stalk the shadows. Every punch, every beam, every choice shapes history.

⚔️ Plot System
» A-Plots – Admin-led, canon, world-shaking.
» B-Plots – Player + admin collab, canon, medium scale.
» C-Plots – Player-run, flexible, fun, sometimes canon.

✨ Features
» Unique stat-based combat system (Ki • Effort • Magic).
» Automation bots keep fights fast & fair.
» OC-driven stories – forge your own legend.
» 18+ only, zero-tolerance for harassment.

👊 Will you fight for glory, survival, or something greater?
The World is waiting.

Today's activity
71💬
14🟢
12👥
5📞
Server overview
40👥Total members
2📅months old
18+Age requirement
Description

A Hunger Games roleplay!

Today's activity
1.7k💬
40🟢
37👥
0📞
Server overview
118👥Total members
3📅years old
16+Age requirement
server profile pic
PANDÆMONIUM: REBIRTH [BETA]
hazbin hotelhazbin hotel rphelluva bosshelluva boss rproleplay
user profile pic
bearerofbonez06-09-2025 21:48

We're finally up! Woo-hoo!

Description

# ⛧ | 𝓦𝓮𝓵𝓬𝓸𝓶𝓮 𝓽𝓸 𝓪 𝓷𝓮𝔀 𝓗𝓮𝓵𝓵. | ⛤
## ------------------------------------
***𝓗𝓮𝓵𝓵 𝓲𝓼 𝓲𝓷𝓯𝓲𝓷𝓲𝓽𝓮.*** Each possible land of the damned you could possibly imagine within a snowglobe on the desk of the Devil, so to speak.

His own daughter thought that perhaps redemption was an option for these damned souls, and Helel, stuck in his own ways, banished his own kin into the depths of hellfire he created.

But he was not careful as to which Hell he picked. Paranoid, he sent his right hand to oversee her. And as he expected, he witnessed her influence spreading to the Hell she now resided in, a Hell untouched for to long by Helel's governance. A Hell upturned. And now, a new variable was being added to the equation.

# 🖤 𝐈𝐬 𝐇𝐞𝐥𝐥 𝐭𝐫𝐮𝐥𝐲 𝐟𝐨𝐫𝐞𝐯𝐞𝐫?🌹

## ------------------------------------

Welcome, oh welcome, to PANDÆMONIUM: REBIRTH, a server where the destiny of the past is reforged and redemption is more possible than before. Now, this server is very different than other servers in that we operate on a server-only lore seperate from Hazbin Hotel and Helluva Boss. As such, I completely understand if you're uninterested in our server. But fear not! As disorienting as it may be, this means you can help expand the story with your own ideas! You can pull the reins and create the server's story alongside a welcoming community without the restrictions of canon!

Hopefully something like that is enticing. And if it is, we welcome you.

Today's activity
5💬
14🟢
3👥
0📞
Server overview
36👥Total members
2📅months old
18+Age requirement
server profile pic
Tales of Ideals
roleplaysuperherosuperheroes
user profile pic
the_sigg02-09-2024 13:23

Testing!

user profile pic
the_sigg02-09-2024 13:24

Hey there, get in!

Description

***For as long as humans have dreamed, we have dreamed of heroes.*** ***What if these dreams could come true? Could the world handle such power?*** ***These are...*** # _ _ _ _ 『 𝕋𝕒𝕝𝕖𝕤 𝕠𝕗 𝕀𝕕𝕖𝕒𝕝𝕤 』 _ _ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ Set in an alternate history version of our world, __**Tales of Ideals**__ tells the story of a world where superheroes have gone all but extinct. Following the destruction of much of civilization, society has lost faith in its protectors. In the United States, those that remain are under the watch of the **Superhuman Public Response** team. Now, in the year 2024, the balance of the world is in the hands of a new age of superheroes. Stagnant for decades, it is finally time for them to rise up again... but will they succeed? Will crime and villainy prevail at last? Or will this age die out before it gets going, and force the world to recover without supers? ### *The future is up to you!* _ _ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ## 𝓕𝓔𝓐𝓣𝓤𝓡𝓘𝓝𝓖: 💥 A world with decades of alternate history to discover! 🌎 Over **60** channels to roleplay in! 👊 The ability to create your own superheroes (or villains!) 🔥 A narrative focused approach, with an evolving world! ⚡ A class- & archetype-based system of character growth!

Today's activity
8💬
20🟢
3👥
0📞
Server overview
44👥Total members
1📅years old
18+Age requirement
server profile pic
Taisho High: The First Aces!
fantasyhighschoolmagicocroleplaysci-fi
Description

WELCOME TO THE GRAND REOPENING OF TAISHO HIGH!

Whether you're a visitor looking in, or returning member, we welcome you with open arms! We're an exciting high school based RP server, which takes place further inti the future!

✨Rise through the ranks and discover your true power! ✨

At taisho high, you can expect:

* An easy to understand class system

* Wide range of freedom for OC'S

* Several opportunities for deep character development

* Engaging events, with valuable server rewards

* Helpful staff

* Progression of power

And much more!

Will you become a true Ace?

Today's activity
1.2k💬
29🟢
15👥
0📞
Server overview
59👥Total members
2📅years old
13+Age requirement
server profile pic
RP n’ Chill
role-playroleplay
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
297💬
179🟢
31👥
0📞
Server overview
1.1k👥Total members
5📅years old
15+Age requirement
server profile pic
Mega Man X: Sirens in the Distance
mega manmegamanmega man xmegaman xroleplay
Description

Sirens in the Distance is a 20+ roleplay server, set in the Mega Man X timeline. We are a living and evolving alternate universe, giving players opportunities to introduce their own stories and expand on the MMX lore. We offer a mature, sandbox-style setting, with multiple open-ended plots, allowing players to meaningfully change the course of the Maverick Wars. We are new player-friendly! Prior knowledge of the MMX setting is not required. Canons, OCs and fangame characters are welcome! So come check us out!

Today's activity
94💬
22🟢
6👥
0📞
Server overview
51👥Total members
1📅years old
18+Age requirement
server profile pic
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
230💬
53🟢
22👥
0📞
Server overview
222👥Total members
2📅years old
13+Age requirement
server profile pic
The Democratic Server of Kaeska
political roleplaypoliticschattingroleplay
Description

The Democratic Server of Kaeska is a place where YOU can take charge. Create or join the political parties of your dreams. Run for President. Create laws. Vote on issues. Win the hearts of your fellow servermates. Created and moderated by an experienced team of people, we feature a custom discord bot, and a thriving community. Will Kaeska be the perfect utopia? Or will you run it into the ground? The choice is YOURS. Welcome to the Democratic Server of Kaeska.

Today's activity
6💬
30🟢
3👥
0📞
Server overview
104👥Total members
9📅months old
13+Age requirement
Description

"You'll face death, and it won't be pretty.
Enough death to leave your broken, time and time again...."

Congratulations! The application you submitted to become a part of Project Epsilon has been accepted! Welcome aboard!

Hello and a warm welcome to Halo: Project Epsilon! This is a server where you take the role as an agent of Epsilon. You will embark on a whole variety of missions to various ancient and fantastical planets (created by yours truly) to combat the rising power of the evil Red Talon corporation. While working alone in this server is plausible, it is also foolish. We here at Epsilon are huge advocates for teamwork as it not only improves overall RP experience, but it also leads to more interesting and diverse scenarios for you and your new friends to enjoy. You heard me right, friends! Epsilon gladly welcomes anyone of any race, culture, background or identity, regardless of whether or not you are a member of the LGBTQ+ or if you are just an 8ft tall Sangheili, we are all friends here!

This is based on Red VS Blue’s project freelancer and is a custom rp server that involves:
- Team based mission RP 🕴️
- A competitive leaderboard to flex on all your pals 💪
- Frequent and inclusive events (nitro) 🫨
- Friendly staff who will be your new best friends 😎
- Acceptance of everyone, unless you are from Formby, which case I want my money back 🏳️‍🌈
- POKECORD 🦆
- Comedy 🤓
- Women (I think)🤷
- HUNGER GAMES! 🕺
- CQ Cumber 🐐
So if you like what I described and you think this server fits your vibe. Join! I would love to see you there and so would everyone else. If you still have any questions then all you got to do is ask me or our dedicated staff team (I love them) who will gladly offer assistance to solve any quibbles and quabbles you may have. I truly hope to see you there.

-Colorado

Today's activity
210💬
24🟢
10👥
0📞
Server overview
132👥Total members
5📅years old
13+Age requirement
server profile pic
Øm̷n̷ɨvɇɍs̷a̷ł Ȼøłłɨs̷ɨøn̷
crossovermultiversemultiverse rproleplayroleplay crossover
Description

Somehow, World after World, it went black, straight after, characters from other worlds collided with a new world. These versions however, are unstable. Yet no one but the Vessels knew. A group who knows the real truth, and want to fix it. They believe there isn't much they can do, but maybe You can change that.

- Become a Vessel, a Citizen, A king. All roles are needed and can be played as much as possible.

- Participate as the main cast, or just roleplay for fun here.

- Fight or Help others, your free to choose.

- Explore around. Maybe you'll find a new place.

Hopefully you'll enjoy this server.

Today's activity
184💬
68🟢
21👥
0📞
Server overview
276👥Total members
1📅years old
15+Age requirement
Description

A pretty chill Kirby Roleplay server. Just follow the rules and you’ll have fun. We’re currently a small server and we hope to see you join

Today's activity
384💬
19🟢
8👥
0📞
Server overview
51👥Total members
5📅months old
13+Age requirement
server profile pic
AI Buddies
aianimechattingcommunitygirlsmangensfwroleplaysocial
Description

Looking for great AI conversations? Chat with top-notch AIs directly on Discord through PM Choose your favorite AI Buddy and start chatting! New AIs are added regularly, and they’re free to try

Today's activity
28💬
113🟢
26👥
0📞
Server overview
2.5k👥Total members
1📅years old
18+Age requirement
server profile pic
the Eternity
horrorroleplaywriting
Description

a new, somewhat horror based rp server set in a luxury hotel. Ocs and canon characters are allowed. We're just starting off, so join now!

Today's activity
163💬
7🟢
5👥
0📞
Server overview
17👥Total members
2📅years old
16+Age requirement
server profile pic
" Hold On " !! Detroit Become Human RP
dbhdetroit become humanroleplaydbh rpcommunitygamehangoutrp
Description

𖦹ㅤ ̼ ₊ㅤㅤLOADING. . . ㅤ ۪ ֹ

Detroit 2038. Technology has evolved to a point where human-like androids are everywhere. They speak, move and behave like human beings, but they are only machines serving humans. Play three distinct androids and see a world at the brink of chaos – perhaps our future - through their eyes

>﹒Main characters. Funny thing to call people. The world doesn't have main characters. They are just people that suffer and those who cause pain.

A free will. Yes, that's what is causing pain and chaos. There's no "choose" option anymore. There are just people and their will.

Think wisely. Nothing happens without a reason . . .

. . .
. . . . . .

> LOADING FINISHED

> PROCESS TO CONTINUE?
> YES > NO


⊹ ⠀࣪⠀ㅤㅤ ㅤ OUR OFFERT. . . ִ
> many free cc
> helpful crew including admins and mods
> chance to write your own storyline
> oc friendly
> safe community
> semi-lit / literate community
↷﹒⇆﹒

Today's activity
87💬
23🟢
5👥
0📞
Server overview
113👥Total members
11📅months old
13+Age requirement
Description

a good roleplay server with a gossip girl based lore!

Today's activity
290💬
40🟢
11👥
0📞
Server overview
320👥Total members
2📅years old
13+Age requirement
server profile pic
Avalon Community Servers
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
50💬
117🟢
7👥
0📞
Server overview
976👥Total members
8📅years old
13+Age requirement
server profile pic
/pupcore ‧˚🐾⋆🦴୭
communitysocialchillroleplayhangoutmusicfurryrpnon-toxic18+
Description

Haiii you've discovered /pupcore! Welcome to a friendly, non-toxic pet-play server for the silly, whimsical, and playful! Whether you're a pup, owner, or just looking for a community, come fetch your spot! Psst — new pups get a treat! 𐂯 >.<

🦴 | Accepting friendly space! ♡

🦴 | SFW mostly, no NSFW focus!

🦴 | Cute emotes & stickers!

🦴 | Intro + looking for channels!

i hope to see you there! ^-^

Today's activity
48💬
39🟢
13👥
0📞
Server overview
61👥Total members
1📅months old
18+Age requirement
Description

+ ━━━━☆ WELCOME TO THE GREENFIELD ACADEMY! ☆━━━━ +

Embark on a thrilling journey into the extraordinary at Greenfield Academy, where the year is 2044, and a new generation of heroes is rising. Dive into a captivating server where you have the power to shape your own original characters and unfold epic tales of heroism and discovery!

✨ Unleash Your Superhuman Potential ✨

Step into the bustling metropolis of Charter City, home to Greenfield Academy, a prestigious institution for molding future heroes. The students possess unique powers inherited from their grandparents who experienced an event known as "The Black Hole Incident." Explore a world where extraordinary abilities are the norm, and the line between hero and villain blurs.

🦸 Craft Your Heroic Legacy 🦸

Create your very own OC, from their compelling backstory to the depths of their superhuman abilities. Immerse yourself in a universe that celebrates originality, where your character's journey is untethered from existing storylines. Join forces with other members to weave tales of heroism, friendship, and self-discovery.

🚀 Soar Above the Rest 🚀

Here at Greenfield Academy, originality reigns supreme. Engage in a rich lore, explore diverse channels to enhance your OC's story, and immerse yourself in a non-toxic community that values creativity and collaboration. We understand the importance of real life, so join roleplays at your own pace without pressure.

What We Offer

- A unique roleplaying experience within the Greenfield Academy universe.
- Diverse channels for character development (Designs, Theme songs, Headcanons, Etc.).
- A welcoming and non-toxic community.
- Flexibility in roleplay participation, attend when you can.

Join us at Greenfield Academy, where destinies are forged, and the legacy of the next generation of heroes begins. Uncover your superhuman potential and let the adventure unfold!

Join the Journey Today!

Today's activity
38💬
31🟢
8👥
0📞
Server overview
97👥Total members
3📅years old
13+Age requirement
server profile pic
|| JJK || The Jujutsu Experience
jjkjjk roleplayjjk rpjujutsu kaisenjujutsu kaisen roleplayjujutsu kaisen rproleplay
user profile pic
gumeybear2122-09-2024 13:04

a

Description

The Jujutsu Experience! It's a roleplaying/hangout JJK server!! Your oc's make the future! It's simple and an up n' coming server. - Cannon Techniques to be claimed by YOUR ocs ;o - Friendly staff (I think I'm friendly anyways) - Easy to understand templates - Sukuna's vessel up for grabs >:)) So why don't you come on down and join! Even if you just want to hangout and chat, that's what we're here for, but if you want to rp, come make an oc that'll shape the lore of the server!

Today's activity
2.8k💬
70🟢
38👥
6📞
Server overview
200👥Total members
1📅years old
13+Age requirement
server profile pic
Rus' | Into The Frost
adventurefantasymedievalroleplay
Description

With a long winter preparing to encapsulate the Tsardom of Rus' and all living things within the Russkaya Zemlya, we invite you to join us in the new and improved Rus' Universe. Dobro pozhalovat' v Rus! Welcome to the Rus', my friend. The "Rus' | Into The Frost" is a server based on 15th-Century Medieval Russia with a fantasy twist. Imagine a world where legendary creatures found in traditional folklore coexisted alongside ManKind. It is in our universe that adventurers from all corners of the globe travel to the Land of the Rus' to test their mettle against the ferocious beasts that dominate the cold lands. Limited by only your own brilliant creativity, you are allowed to start off as a majestic and nimble Kitsune from the Far East—using magic to turn your foes to dust. You can even try to slay beasts as an Elven Archer from the Germanic Region who can strike down their prey from miles away, a werewolf, vampire, orc, and so much more. Don't be afraid to strive for whatever your artistic mind desires. This is a community that accepts all passionate to write, role-play, and help build an immersive universe influenced by its members and everything we do as a community. Upon joining, we ask that you take the time to read the instructions provided in our welcome channel. We are a very well-written and fleshed-out server. We hope that you'll be joining us very soon on our courageous adventures, friend.

Today's activity
31💬
19🟢
6👥
0📞
Server overview
43👥Total members
3📅years old
18+Age requirement
server profile pic
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
1.9k💬
725🟢
79👥
10📞
Server overview
4.9k👥Total members
4📅years old
13+Age requirement
server profile pic
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
320💬
1.6k🟢
32👥
12📞
Server overview
12.3k👥Total members
8📅years old
13+Age requirement
server profile pic
R&Dé
communityroleplayboard gamesfrance
user profile pic
.tzen17-09-2024 17:22

Bonsoir à tous !

user profile pic
.tzen18-09-2024 09:27

Le Monopoly c'est super (non)

user profile pic
.tzen15-10-2025 10:28

Bienvenue à tous les créateurs et passionnés de jeux de société !

user profile pic
.tzen15-10-2025 18:55

Yoyoyo

user profile pic
.tzen16-10-2025 18:55

Jeux de soc.

user profile pic
.tzen17-10-2025 10:02

Bienvenue !

Description

🎲 Bienvenue sur R&Dé ! C'est LA communauté qui rapproche joueurs passionnés et créateurs chevronnés. Rejoignez des conversations animées sur les derniers jeux, découvrez des stratégies, échangez des astuces et trouvez des partenaires pour des parties endiablées. Nous organisons régulièrement des soirées de jeu, de création, des tournois et des événements spéciaux comme des game jams. Entrez dans la famille ludique R&Dé ! Tous : • partagez vos coups de cœurs • découvrez des nouveautés • trouvez des compagnons de jeu • jouez ensemble • partagez des stratégies • accès exclusif à des prototypes originaux Créateurs : • bénéficiez du retour des joueurs • demandez des conseils • partagez vos expériences Ensemble, inventons les classiques de demain ! Suivez-nous sur les réseaux et partagez à vos amis joueurs : • Twitch https://www.twitch.tv/rdegames • X TBD • Facebook TBD • Youtube TBD • Discord https://discord.gg/CFutHdqjRh

Today's activity
18💬
18🟢
6👥
0📞
Server overview
195👥Total members
1📅years old
13+Age requirement
server profile pic
Sauce
socialcommunitychillroleplaygamesanimefriendsactivemoviesegirlfreakyactive-voicechatdatingedating
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
4.3k💬
107🟢
42👥
0📞
Server overview
1.0k👥Total members
9📅months old
13+Age requirement
server profile pic
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
217💬
31🟢
13👥
1📞
Server overview
96👥Total members
1📅years old
16+Age requirement
server profile pic
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
300💬
67🟢
28👥
3📞
Server overview
312👥Total members
3📅years old
16+Age requirement
Description

[QUICK DISCLAIMER: This is a ROLEPLAY server. If you are here to trade, do not join.] 2 worlds exist, the human world, and the Yo Kai World. They used to be separate, but some time, long ago in the past, their borders got hazy and Yo-Kai started to pour in, and cause all sorts of troubles for humans! Completely invisible to the human eye, they inspirit people and cause problems ranging from the mild annoyance to major danger. Luckily, a device exists to allow humans to see and even befriend the Yo-Kai! Can a peace be reached between the 2 worlds, or is an unseen catastrophe right on the horizon?

Today's activity
15💬
40🟢
6👥
0📞
Server overview
237👥Total members
4📅years old
13+Age requirement
server profile pic
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
35💬
45🟢
9👥
0📞
Server overview
130👥Total members
4📅years old
15+Age requirement
server profile pic
Void's End|R2E Alpha
communitydark soulselden ringroleplayworld of warcraftwow
Description

Void's End is a roleplaying server with its own system inspired by world of warcraft, dark souls, and some other things. We accept suggestions to add more, come join us today!

Today's activity
691💬
7🟢
2👥
0📞
Server overview
15👥Total members
1📅years old
13+Age requirement
server profile pic
Bleach: Phantom Conflict the sequel
animeanime roleplayanime rpbleachbleach roleplaybleach rpcommunityroleplay
Description

**. . . . . ╰──╮Bleach: Fall of The Soul Society╭──╯ . . . . .**

In this world, everything in this realm relies on balance. Everything has a process and everything has a flow. In the same way which life has a process, so does death. When a life ends, there is far more to explore. As a matter of fact, one may have access to more in death than they once had in life

A soul can take a variety of paths. A soul may fall with order and a desire to keep peace. One may fall with justice and a wish to destroy the unjust. While others may be fueled with an unimaginable, all consuming darkness.

Welcome to *Bleach: Fall of The Soul Society*! Glad you've decided to take a look at our server. We're happy to introduce you to our

˚₊· ͟͟͞➳❥ Entertaining community

˚₊· ͟͟͞➳❥ Efficient admin team

˚₊· ͟͟͞➳❥ Frequent discussions and conversational topics

˚₊· ͟͟͞➳❥ Variety of different roleplayers with different goals

˚₊· ͟͟͞➳❥ No shortage of roleplay options or locations

˚₊· ͟͟͞➳❥ Simple but effective ranking system for better combat

We hope to see you here. Enjoy yourself!

Today's activity
72💬
15🟢
1👥
0📞
Server overview
40👥Total members
2📅years old
16+Age requirement
Description

Welcome to 𝐇𝐨𝐫𝐬𝐞𝐬𝐡𝐨𝐞 𝐎𝐯𝐞𝐫𝐥𝐨𝐨𝐤! This is a NEW third person literate canon ONLY Red Dead Redemption server! This is an 18+ ONLY server so minors are prohibited. Here we offer a canon story based lore as well as creating your own roleplays and interactions!

Here we have:

Self Roles! 🏜️

Many open canon characters! 🤠

Tupper bot! 🌵

Friendly members! ❤️

Announcements and events!!📣

Feel free to join and be part of this lil family! 🪶🏜️

Today's activity
19💬
9🟢
2👥
0📞
Server overview
14👥Total members
1📅years old
18+Age requirement
server profile pic
The MegaCountry SMP - LAUNCH ????
gamesminecraftminecraft smpminecraft-java-editionrp minecraft gamingroleplaymoddedmodsgamingcommunityfunsfwpoliticsnontoxic
user profile pic
youthd4814-12-2024 08:26

This server is awesome!

Description

📜 🌎 Welcome to the MegaCountry SMP, a new modded Minecraft SMP with 30+ players that will start operations soon! We are a modded Minecraft PolSim SMP with many ways to run things! Work your way up the ranks from resident to president, and forge alliances with other players across the multiple city-states! As more players join the SMP, the city-states available to join and lead will increase! Will you lead your city-state to prosperity? Or will your city-state fall to ruin? Our server is nontoxic and strictly adheres to Discord's Community Guidelines. Join us! Your story is what you make of it, and it'll be awesome!

Today's activity
14💬
30🟢
1👥
0📞
Server overview
81👥Total members
1📅years old
13+Age requirement
server profile pic
The Underverse
lgbtq+lgbtqialgbtqia+ roleplayroleplayunderfellundertaleunderverse
user profile pic
fell_sans_simp29-12-2023 22:24

Join for Undertale friends!!

Description

LOOKING FOR MODS!! 15+ ONLY SERVER! Please don't join if you're under 15. Hello! This is a new server that I created for all of the “weird kids” that never grew out of their Undertale phase. It's NOT just a roleplay server but there are roleplay channels for those interested! I worked really hard on it, so I'd really appreciate anyone who'd like to join and come hang out :3

Today's activity
10💬
15🟢
1👥
0📞
Server overview
92👥Total members
1📅years old
15+Age requirement
server profile pic
Booty Owl ✩₊˚.⋆☾𓅔☽⋆⁺₊✧
rpfantasyvchangoutcreativefriendlyfriendsfunchatart18+roleplaygamingchillactivesocialcommunity
user profile pic
vin873425-09-2025 13:40

welcome to the dumpster fire!

Description

Welcome to the Booty Owl community! It's a galaxy far, far beyond Discord servers. May the owls be with you, always!

Today's activity
9💬
18🟢
1👥
2📞
Server overview
40👥Total members
1📅years old
18+Age requirement
server profile pic
Animation Destination Roleplay
roleplayDisneyDreamWorksilluminationNickelodeon
Description

Hi! I'm looking for mature people or people 18 years of age and older that love animation to join a Discord roleplay. Roleplay in any style you want. You can choose animated characters from Disney, DreamWorks, Illumination, Nickelodeon, and more. Hope to see you there!

Today's activity
9💬
10🟢
2👥
0📞
Server overview
33👥Total members
7📅months old
18+Age requirement
server profile pic
Dirac Sea
falling frontierroleplayspacethe expansethe sojourn
user profile pic
theonlychen29-08-2023 23:02

We are now cooking with Fusion Fuel

user profile pic
slava_rossii129-08-2023 23:05

This is Captain Lennox Kamal of the Martian Federal Navy, stop right there Rim Periphery Union scum!

user profile pic
aurai_the_trickster30-08-2023 01:51

Want to fire trash cannons and oversized flares at your enemies? Then the Snatchers have you covered!

user profile pic
slava_rossii130-08-2023 02:46

Can confirm, we have Amazon same day delivery services, and the package is a surprise until you join.

user profile pic
slava_rossii129-09-2023 06:12

Okay, ignore my review above, about time for a serious review. To put it simply this server is basically a spin off of The Expanse by James S.A. Corey. Some factions are basically rebranded versions of their factions in the books, such as IPA-UN, MF-MCR, BPU-OPA. On top of that there are unique factions with their own doctrine and technology to name them all, the Rim Periphery Union, and Kuiper Security Pact. Each has their own advantages and disadvantages, the players here do not need to worry about bullshit like shields that cancel out whatever you thrown at it and devolving into an endless argument about who has better technology. Only thing going on is your tactics, maneuvers and exploiting your own advantages and your enemies disadvantages

user profile pic
zolar15902-10-2023 07:29

l

Description

Dirac sea is a spacefaring roleplay and community inspired by the likes of The Expanse, Falling Frontier, and Nebulos fleet command. It is now the 25th century, and humanity has now long since left the confines of its home planet and have colonized vast swathes of the solar system. The invention of the epstien and wormhole jump drives has allowed travel times that would previously take years be done in a matter of weeks or even days, even as far as to help humanity verify the existence of planet 9, later colonized and named as Pales. However, as is typical with humanity and the conflicts they sow, summarized in the words of a asteroid belt miner: “Humanity had a garden that was filled with riches of water, air, and a blue sky. And yet, they not only almost destroyed that garden, they looked past the sky into the stars and beyond. And the first thought that came to their mind was not that of wonder or reverence, but one word: ‘Mine.’”

Today's activity
8💬
22🟢
2👥
0📞
Server overview
56👥Total members
2📅years old
13+Age requirement
server profile pic
Oaths of Steel
roleplayroleplayinghouse of the dragongame of thrones
Description

🏰 Oaths of Steel | House of the Dragon RP 🐉

Enter the world of Westeros, where loyalties can shift like the wind and the bold carve their names into history.

🔥 Year 115 AC. The realm flourishes under the rule of Queen Vaelana Targaryen, First of Her Name. With dragons soaring above Westeros and noble houses vying for influence, the Iron Throne sits ever vulnerable to ambition, treachery, and blood.

Oaths of Steel is an immersive, literate roleplaying server set in the brutal and beautiful world of Game of Thrones / A Song of Ice and Fire (Set in the era of House of the Dragon). Whether you're a scheming noble in King’s Landing, a Night’s Watch ranger at the Wall, or a Knight claiming glory in battle — your story begins here.

🌐 What We Offer:

📜 Original Characters

🗺️ Detailed maps, custom lore channels, and deep worldbuilding.

⚔️ Political Intrigue & War

🐉 Player-driven plots with mod-run events and consequences.

🐺 All Houses Open (except Targaryen (for now!))

🕊️ LGBTQ+ friendly, 17+ community

🎭 Come if you love:

Deep character arcs

Strategic alliances & betrayal

Lore-rich fantasy settings

Join us. Swear your oath. Shape the realm.

"The game is yours to play — and the price is yours to pay."

Today's activity
4💬
14🟢
2👥
0📞
Server overview
20👥Total members
2📅years old
17+Age requirement

215 servers found